KEGG   Rickettsia prowazekii NMRC Madrid E: H374_3110Help
Entry
H374_3110         CDS       T02544                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase (Beta-ketothiolase) protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpn  Rickettsia prowazekii NMRC Madrid E
Pathway
rpn00071  Fatty acid degradation
rpn00280  Valine, leucine and isoleucine degradation
rpn00310  Lysine degradation
rpn00362  Benzoate degradation
rpn00380  Tryptophan metabolism
rpn00620  Pyruvate metabolism
rpn00630  Glyoxylate and dicarboxylate metabolism
rpn00640  Propanoate metabolism
rpn00650  Butanoate metabolism
rpn00900  Terpenoid backbone biosynthesis
rpn01100  Metabolic pathways
rpn01110  Biosynthesis of secondary metabolites
rpn01120  Microbial metabolism in diverse environments
rpn01130  Biosynthesis of antibiotics
rpn01200  Carbon metabolism
rpn01212  Fatty acid metabolism
rpn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H374_3110
   00630 Glyoxylate and dicarboxylate metabolism
    H374_3110
   00640 Propanoate metabolism
    H374_3110
   00650 Butanoate metabolism
    H374_3110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H374_3110
   00072 Synthesis and degradation of ketone bodies
    H374_3110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H374_3110
   00310 Lysine degradation
    H374_3110
   00380 Tryptophan metabolism
    H374_3110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H374_3110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H374_3110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H374_3110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpn04147]
    H374_3110
Enzymes [BR:rpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H374_3110
Exosome [BR:rpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H374_3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-GeneID: 15150083
NCBI-ProteinID: AGJ01599
Position
370208..371386
Genome map
AA seq 392 aa AA seqDB search
MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITG
GSGQNPARQTLIYADIPQEVPGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMS
LGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDAFAL
SSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRHNTSIEILSKLRPAFDKNGV
VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLIT
LIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtcttagtacaattccagcaccaatgttagctgcttatttaatcaaggatatactgcaa
aatagtaaaatcgagcctgctttagtaaatgaggtaatacttggacaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgccgatataccgcaagaagtt
ccaggttatactattaataaagtatgtggctcaggtcttaaaagtatagcacttgcagca
aattcaattattacatgcgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggatctaaattcggcgatatcaaaatggtt
gatctcatgcaatatgatggtttaatagatgtattttcaggagtatttatgggtattact
gccgaaaatatcgcgaagcagtttaatattagtcggcaagagcaggacgcattcgcctta
agttctcacaagaaagctgctaaagcacaattatcaggaattctacaagatgaaatcttg
cctatagaggtaacagtaaaaaaaaatactagtttgtttgatcatgatgaaacagtaaga
cataatacaagcattgaaattcttagtaaattacgccctgcttttgataaaaatggtgta
gttacagctggtaactcttcctctattaatgacggtgcagcatgtgttctgcttgtttca
gaaaaagctttgaagaaacataatttaacaccgttagcgcgtattgtttcttgggcttca
gctggtgttgatccaagaattatgggtactgcacctgtacctgcatctaaaaaagcatta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgca
gcacaaagtatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggcgcaagtggtggacgtcttcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtattggtatttctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system