KEGG   Rickettsia prowazekii NMRC Madrid E: H374_3710Help
Entry
H374_3710         CDS       T02544                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rpn  Rickettsia prowazekii NMRC Madrid E
Pathway
rpn00450  Selenocompound metabolism
rpn00970  Aminoacyl-tRNA biosynthesis
rpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    H374_3710
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H374_3710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpn01007]
    H374_3710
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpn03016]
    H374_3710
Enzymes [BR:rpn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     H374_3710
Amino acid related enzymes [BR:rpn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   H374_3710
Transfer RNA biogenesis [BR:rpn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    H374_3710
 Prokaryotic type
   Other AARSs
    H374_3710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 15150145
NCBI-ProteinID: AGJ01659
Position
444911..446437
Genome map
AA seq 508 aa AA seqDB search
MKNTYYITTPIYYVNDVAHIGHAYTSVASDVIARFMRFCGKDVMFLTGTDEHGQKVEKAA
INQNIDPQTFTDKTSQNFRDLMVAMNISNDDFIRTTENRHKKAVAVFWKKLLDNGAIYEG
FYEGWYSVRDEAFYDESEINEDKLAPTGAPVEWVKEPSYFFNLAKWQDKLLEFYELNPDF
VRPISRRNEVISFIKSGLKDLSISRTTFHWGIKVPNNRKHVIYVWLDALVNYISALGYPD
KQSNYAKFWPANLQIVGKDILRFHAVYWPAFLMAAEIPLPKAIMVHGWWTNEGQKISKSL
GNTIDPITLIDEFGVDQVRYFLMREVIFGADANFARNNLITRINSELSNKIGNLLHRIVS
FVYKNNDAKVPLIKSGVIDKIYELPILKTAIKFAQENILLMDKTEINKILENIINLAEDA
NIYITNEAPWNLKTTDPDKMLEVLYSLLEVLRYIAIMLQPFVPNSANKMLDQLGVSKEER
LFKHLVRDHALKAGSNILEPSIIFPKFN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacttactatattactacccctatatattatgttaatgatgttgcccatatc
ggtcacgcttatactagtgttgcaagtgatgttattgcccgttttatgcgtttttgcggt
aaggatgtaatgtttctaacaggtactgatgaacatggacaaaaagtagaaaaagcagct
attaatcaaaatattgatcctcaaacatttactgataagacgtcacaaaattttcgtgat
cttatggttgcaatgaatatttctaatgatgattttattagaacaactgaaaatagacac
aaaaaagctgtagccgttttttggaagaaattactagataatggtgcaatctatgaagga
ttttatgagggttggtattcagtgcgtgatgaggctttttatgatgaatcagagataaat
gaagataaattagcaccaactggagcgcctgttgaatgggttaaagaaccaagctatttc
tttaatcttgcaaaatggcaagataaattacttgagttttatgagctaaaccctgatttt
gtcagaccaatatcaaggcgtaatgaagtaattagctttattaaatcaggtctaaaagat
ttatccatatcacgcactacttttcattggggaatcaaagtaccaaataatagaaaacat
gtaatttatgtttggctagatgcacttgttaattatatttcagcacttggttatcctgat
aaacaaagtaattatgccaagttttggcctgctaatttacaaatagtaggtaaggatata
ttgcgttttcatgctgtatattggcctgctttcttaatggctgcggaaattccactgcca
aaggcaattatggtacatggttggtggactaatgagggacagaagatttctaaatctctg
ggtaataccattgatccgattacattaatcgatgaatttggtgttgatcaggttaggtat
tttcttatgcgtgaagtcatttttggggcagatgctaattttgctcgtaataatttaatt
acacgtattaatagtgaactttcaaataaaataggtaatttattacatcgtattgtatct
tttgtttataagaataatgatgctaaagttcctttgattaagtcaggtgttatagataaa
atatatgagctcccgattttaaaaaccgcaattaaatttgctcaagagaatattttattg
atggataaaacagagattaataaaattcttgaaaatattattaatttggctgaagatgca
aatatctatattactaatgaagcgccttggaatttaaaaacaactgatcctgataagatg
ttagaggtgttatattctctgttagaagtactacgttatattgcaataatgcttcagcct
tttgtaccaaattcagcaaataaaatgttagatcagttaggagtatctaaagaagagaga
ttatttaaacatctagtacgtgatcatgctttaaaagcaggtagtaatattttagagcct
agtataatttttccaaagtttaactag

DBGET integrated database retrieval system