KEGG   Rodentibacter pneumotropicus: NCTC8284_00012Help
Entry
NCTC8284_00012    CDS       T05800                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00030  Pentose phosphate pathway
rpne00480  Glutathione metabolism
rpne01100  Metabolic pathways
rpne01110  Biosynthesis of secondary metabolites
rpne01120  Microbial metabolism in diverse environments
rpne01130  Biosynthesis of antibiotics
rpne01200  Carbon metabolism
Module
rpne_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rpne_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NCTC8284_00012 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC8284_00012 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpne04147]
    NCTC8284_00012 (zwf)
Enzymes [BR:rpne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     NCTC8284_00012 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     NCTC8284_00012 (zwf)
Exosome [BR:rpne04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NCTC8284_00012 (zwf)
  Exosomal proteins of colorectal cancer cells
   NCTC8284_00012 (zwf)
  Exosomal proteins of bladder cancer cells
   NCTC8284_00012 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: VEH64890
UniProt: A0A3S4XYQ6
Position
1:complement(9208..10692)
Genome map
AA seq 494 aa AA seqDB search
MQTENSCIVIFGASGDLTHRKLIPALYNLFKIGRLGGNFSVLGVARSELNDETFRTKMRE
ALINNEDTTPETLDEFCHHLYYQSVNTADAADYGKLVPRLDELHDKYQTCGNTLYYMSTP
PSLYGVIPECLAAHGLNTEEYGWKRIIVEKPFGYDEKTAQVLDVQIHRFFEEHQIYRIDH
YLGKETVQNLLVLRFSNGWFEPLWNRNFIDYVEITGAESIGVEERGGYYDGSGAMRDMFQ
NHLLQVLAMVAMEPPAIINADSMRDEVAKVMHCLRPLTQEDVEHSLVLGQYVAGEVNGKM
VKGYLEEKGVPADSHTETYIALRCEIENWRWAGVPFYVRTGKRLPARVTEIVIHFKTTPH
PVFSQNAPENKLIIRIQPDEGISMRFGLKKPGAGFEAKEVSMDFRYADLAGAQVLTAYER
LLLDAMKGDATLFARTDAVHAAWKFVQPILDYKANGGRIHDYEAGTWGPVAADKLIARQG
KVWRKPSGLMKKKV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgagaacagctgtatcgtcatttttggcgcatccggtgatttaacccaccga
aaacttattccggcactttataatcttttcaaaatcggacgattaggcgggaacttctct
gtgcttggcgttgcgcgttcggagcttaatgatgaaactttccgtacgaaaatgcgtgaa
gctttaatcaataatgaagataccacacctgaaacccttgatgaattttgccatcatctt
tattaccaatctgtgaatacggcagatgccgcagactatggcaaattagtgcctcgtttg
gacgaattacacgataaatatcagacctgtggcaatacactctattatatgtccacccca
ccaagtctttatggtgtgattcccgaatgcttggcggcacatggtttgaatacggaagaa
tacggttggaaacgtattattgtagaaaagccttttggttacgatgaaaaaacggcgcaa
gtgttggatgtgcaaattcaccgtttctttgaagaacatcaaatctaccgtattgatcat
tatcttggtaaagaaaccgtgcaaaacttactcgtgttgcgtttttccaatggctggttt
gaaccgctttggaatcgtaattttattgattatgttgaaatcaccggtgctgaatccatt
ggcgttgaagagcgtggcggctattatgacggatccggtgcaatgcgggatatgttccaa
aatcacttattacaagtgcttgcaatggtggcaatggaaccgcccgcaatcattaacgcg
gactcaatgcgtgatgaagtagcaaaagtgatgcactgtttacgcccgctcacgcaagag
gatgtggagcatagtttagtgcttggtcaatatgtcgcaggtgaagtgaacggcaaaatg
gtgaagggatatttggaagaaaaaggcgtgccggcagattcacacactgaaacctatatt
gcgttgcgttgtgagatcgaaaactggcgttgggcaggtgtacctttctatgtacgtacc
ggtaaacgtttacctgctcgtgtgacagaaattgtgattcactttaaaaccacgccacat
cctgtatttagccaaaatgcgccggaaaataaactcattatccgtattcaaccggatgaa
ggtatttcaatgcgttttggtttgaaaaaaccgggagcaggctttgaagccaaagaagta
tcaatggatttccgctatgcggatcttgccggagcacaagtactgaccgcttatgaacgt
ttattgctggatgcgatgaaaggtgatgcaaccctattcgcccgtacggatgccgttcat
gctgcatggaaattcgttcaacctattttggattacaaagccaacggcggacgaatccat
gattatgaagccggtacttggggaccggtggcggcggataaactcattgccagacaaggc
aaagtatggcgtaaaccgagtggattgatgaagaaaaaggtataa

DBGET integrated database retrieval system