KEGG   Rodentibacter pneumotropicus: NCTC8284_03063Help
Entry
NCTC8284_03063    CDS       T05800                                 

Gene name
selD_2
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00450  Selenocompound metabolism
rpne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NCTC8284_03063 (selD_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpne03016]
    NCTC8284_03063 (selD_2)
Enzymes [BR:rpne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     NCTC8284_03063 (selD_2)
Transfer RNA biogenesis [BR:rpne03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    NCTC8284_03063 (selD_2)
 Prokaryotic Type
    NCTC8284_03063 (selD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C
Motif
Other DBs
NCBI-ProteinID: VEH67850
UniProt: A0A3S4Y3D4
Position
1:complement(1852621..1853001)
Genome map
AA seq 126 aa AA seqDB search
MKRNASAEVGSKLYLTKPLGIGVLTTAEKKGKLKPEHQGLATAAMCQMNIIGSQFSEVEG
VTAMTDVTGFGLLGHLLEICEGSNLNAELFFDKIPTLEGVSDYILKVAYRVARRVIMRVT
GIKWGH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgaaatgcgtcagccgaggtgggcagtaaactctatttaaccaaacctttgggc
attggggtgctcaccacggcagagaaaaaaggcaaattaaaacctgaacatcaagggtta
gcaacggcagcaatgtgtcaaatgaatattatcggcagccaattttccgaagtggagggg
gttaccgctatgactgacgtgacgggctttggcttactcggtcatttgcttgaaatctgt
gaaggctcaaacctcaatgctgagttgtttttcgataaaattccgactcttgagggcgta
tcggactatattctgaaggttgcgtaccgggtggcacgacgcgtaattatgagagttacg
ggcataaagtggggacattga

DBGET integrated database retrieval system