KEGG   Rodentibacter pneumotropicus: NCTC8284_03131Help
Entry
NCTC8284_03131    CDS       T05800                                 

Gene name
ushA_2
Definition
(GenBank) bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00230  Purine metabolism
rpne00240  Pyrimidine metabolism
rpne00760  Nicotinate and nicotinamide metabolism
rpne01100  Metabolic pathways
rpne01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NCTC8284_03131 (ushA_2)
   00240 Pyrimidine metabolism
    NCTC8284_03131 (ushA_2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NCTC8284_03131 (ushA_2)
Enzymes [BR:rpne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     NCTC8284_03131 (ushA_2)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     NCTC8284_03131 (ushA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LAMTOR5
Motif
Other DBs
NCBI-ProteinID: VEH67916
UniProt: A0A448MS08
Position
1:complement(1893244..1893597)
Genome map
AA seq 117 aa AA seqDB search
MQNAEPDIQAMNAMGYEATVLGNHEFDNPLQMLAMQESWANFPFLSANVINKKTDQPLVK
PYIVLDKQGLKIAVVGLTTEDTAKLGNPEYTGNVVFRDPMESAKETLKALNEKENRM
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgctgaacctgatattcaagcgatgaatgctatgggttatgaggcgacagta
ttaggaaatcacgaatttgataatccactacaaatgcttgctatgcaagaatcttgggcc
aactttccatttttatcggctaatgtgataaacaagaaaacggatcaacctcttgtaaaa
ccttatattgttttagataaacagggattgaaaatagctgttgtcggcttaacgacagaa
gatacggcaaaacttggtaatcctgaatatacagggaatgtggtatttagggatccgatg
gaatccgcaaaagaaacgttaaaagcgttaaatgaaaaagaaaaccggatgtaa

DBGET integrated database retrieval system