KEGG   Rodentibacter pneumotropicus: NCTC8284_03656Help
Entry
NCTC8284_03656    CDS       T05800                                 

Gene name
psd_1
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00564  Glycerophospholipid metabolism
rpne01100  Metabolic pathways
rpne01110  Biosynthesis of secondary metabolites
Module
rpne_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCTC8284_03656 (psd_1)
Enzymes [BR:rpne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     NCTC8284_03656 (psd_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2507
Motif
Other DBs
NCBI-ProteinID: VEH68423
UniProt: A0A3S4XW27
Position
1:2233618..2233845
Genome map
AA seq 75 aa AA seqDB search
MHSISYWQRLKVAFQYVMPQLYLTQFAGWFAKQKWGKVTHLAIKAFAKKYNIDMSIAQKE
QFNEYESFNEFLFVR
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaatttcttattggcaacgcttaaaagttgcttttcaatatgtgatgcctcaa
ctttatttaactcaatttgccggctggtttgcaaagcaaaaatggggcaaagtcacacat
ctcgccattaaagcctttgcgaaaaaatacaacattgatatgagtattgcgcaaaaagaa
caatttaatgaatatgaaagtttcaacgagtttttattcgtccgttaa

DBGET integrated database retrieval system