KEGG   Rickettsia prowazekii BuV67-CWPP: MA1_00260Help
Entry
MA1_00260         CDS       T01788                                 

Gene name
ndk
Definition
(GenBank) mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-phosphodiesterase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rpo  Rickettsia prowazekii BuV67-CWPP
Pathway
rpo00230  Purine metabolism
rpo00240  Pyrimidine metabolism
rpo01100  Metabolic pathways
rpo01110  Biosynthesis of secondary metabolites
rpo01130  Biosynthesis of antibiotics
Module
rpo_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rpo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MA1_00260 (ndk)
   00240 Pyrimidine metabolism
    MA1_00260 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rpo04131]
    MA1_00260 (ndk)
Enzymes [BR:rpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     MA1_00260 (ndk)
Membrane trafficking [BR:rpo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    MA1_00260 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AFE50574
Position
62327..62749
Genome map
AA seq 140 aa AA seqDB search
MTIQYTFSMIKPDVIKRNKIGQVNTYLENAGLKIVAQKMKFLTKYEAECFYDEHRARSFF
NSLVEYITSGAVVLQVLKGEDAITLNRTIMGATNPAEAKEGTIRKDLGESIEANSIHGSD
SENSAKREIKFFFSKSEIIE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacaatatacattctcaatgattaagcctgatgtgatcaagaggaataaaata
ggacaagttaatacttatttggaaaatgcaggcttaaaaatagtagcacagaaaatgaaa
tttttaactaaatatgaagctgagtgtttttatgatgaacatagagcaaggtcgtttttt
aatagcttagttgaatatattacttcaggagcggtagtacttcaagttcttaaaggagaa
gatgctatcactttaaatcgaaccattatgggcgcaactaatcctgctgaagcaaaagaa
ggaactattagaaaagatttaggagaatcaattgaggctaatagtattcatgggtcagat
agtgaaaatagtgcgaaaagagaaatcaaatttttcttttccaaatctgaaattatagaa
taa

DBGET integrated database retrieval system