KEGG   Rickettsia prowazekii BuV67-CWPP: MA1_03555Help
Entry
MA1_03555         CDS       T01788                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpo  Rickettsia prowazekii BuV67-CWPP
Pathway
rpo00071  Fatty acid degradation
rpo00280  Valine, leucine and isoleucine degradation
rpo00310  Lysine degradation
rpo00362  Benzoate degradation
rpo00380  Tryptophan metabolism
rpo00620  Pyruvate metabolism
rpo00630  Glyoxylate and dicarboxylate metabolism
rpo00640  Propanoate metabolism
rpo00650  Butanoate metabolism
rpo00900  Terpenoid backbone biosynthesis
rpo01100  Metabolic pathways
rpo01110  Biosynthesis of secondary metabolites
rpo01120  Microbial metabolism in diverse environments
rpo01130  Biosynthesis of antibiotics
rpo01200  Carbon metabolism
rpo01212  Fatty acid metabolism
rpo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MA1_03555
   00630 Glyoxylate and dicarboxylate metabolism
    MA1_03555
   00640 Propanoate metabolism
    MA1_03555
   00650 Butanoate metabolism
    MA1_03555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MA1_03555
   00072 Synthesis and degradation of ketone bodies
    MA1_03555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MA1_03555
   00310 Lysine degradation
    MA1_03555
   00380 Tryptophan metabolism
    MA1_03555
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MA1_03555
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MA1_03555
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MA1_03555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpo04147]
    MA1_03555
Enzymes [BR:rpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MA1_03555
Exosome [BR:rpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MA1_03555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: AFE51222
Position
complement(924091..925269)
Genome map
AA seq 392 aa AA seqDB search
MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITG
GSGQNPARQTLIYADIPQEVPGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMS
LGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDAFAL
SSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRHNTSIEILSKLRPAFDKNGV
VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLIT
LIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtcttagtacaattccagcaccaatgttagctgcttatttaatcaaggatatactgcaa
aatagtaaaatcgagcctgctttagtaaatgaggtaatacttggacaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgccgatataccgcaagaagtt
ccaggttatactattaataaagtatgtggctcaggtcttaaaagtatagcacttgcagca
aattcaattattacatgcgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggatctaaattcggcgatatcaaaatggtt
gatctcatgcaatatgatggtttaatagatgtattttcaggagtatttatgggtattact
gccgaaaatatcgcgaagcagtttaatattagtcggcaagagcaggacgcattcgcctta
agttctcacaagaaagctgctaaagcacaattatcaggaattctacaagatgaaatcttg
cctatagaggtaacagtaaaaaaaaatactagtttgtttgatcatgatgaaacagtaaga
cataatacaagcattgaaattcttagtaaattacgccctgcttttgataaaaatggtgta
gttacagctggtaactcttcctctattaatgacggtgcagcatgtgttctgcttgtttca
gaaaaagctttgaagaaacataatttaacaccgttagcgcgtattgtttcttgggcttca
gctggtgttgatccaagaattatgggtactgcacctgtacctgcatctaaaaaagcatta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgca
gcacaaagtatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagtggtggacgtcttcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtattggtatttctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system