KEGG   Roseitalea porphyridii: E0E05_00060Help
Entry
E0E05_00060       CDS       T05862                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
rpod  Roseitalea porphyridii
Pathway
rpod00520  Amino sugar and nucleotide sugar metabolism
rpod01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    E0E05_00060 (nagA)
Enzymes [BR:rpod01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     E0E05_00060 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: QBK29121
UniProt: A0A4P6UVD9
Position
14113..15210
Genome map
AA seq 365 aa AA seqDB search
MSAIEGRVLTPDGFRDARVHIEAGRIARIEETGAIASDRLILPGFIDLHCHGGGGADVME
AGDAPRRVAASHARTGTTAFLATTMTAPLDDIEAALAAIEAAAEEPAGDEAAIVGVHLEG
PFISRDRLGAQPDFVIDGDIALIERLMKIARIRVLTCAPEADPDGAMTRWLADRGVRVQL
GHSSCDYETASACFHSGRHGVTHMFNAMSPLHHRAPGIVGAALAHARHAEIIPDLLHVHP
GAIRAALRAIPHLYAVTDATPAAGMPDGDYRLGTQQVRKCGNGVRLADGTLAGSSLTMLQ
ALRNLVEIGLSVEEASQRTSTIAADYLGLEDRGRIVAGAVADLVVLDASLDLREVIMRGR
PIGGS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaatcgagggtcgggtcctgacgcctgacggcttccgcgacgcccgcgtccac
atcgaagccggccgcatcgcgcggatcgaggagacgggggcgatcgcgtccgaccggctg
atcctgcccggcttcatcgatctgcactgccatggcggcggcggcgccgacgtgatggag
gccggcgacgcgccaaggcgcgtggccgcaagccacgcccgcaccggcaccacggcgttt
cttgccacgacgatgaccgcgccccttgacgatatcgaggctgcccttgccgcgatcgag
gctgcggcggaagagcccgccggcgacgaggccgcgatcgtcggcgtgcatctcgaggga
ccgttcatcagtcgcgacaggctcggcgcccagcccgacttcgtgatcgacggcgacatc
gcgctgatcgaacgcctgatgaagatcgcgcgcatacgcgtgctgacatgcgcccccgaa
gccgacccggacggggcgatgacgcgctggcttgccgatcggggcgtgcgcgtgcagctc
ggccattcctcgtgcgactacgagaccgccagcgcctgctttcacagcggtcgccatggc
gtcacccacatgttcaacgccatgtcgccgctgcaccatcgcgcgccaggcatcgtcggc
gcggcgctcgcccatgcccggcacgccgagatcattccggatcttctccacgtccatccg
ggcgcgatccgtgcggcgctgcgtgccatcccgcatctttacgcggtcaccgacgcgaca
ccggccgccggcatgcccgatggcgattaccggctgggcacgcagcaggtcaggaaatgc
ggaaacggcgtgcgtttggccgacggaacgctcgccgggtccagcctgacgatgctgcag
gccctgcgcaatctggtcgagatcggcttgtccgtcgaggaggcctcgcaacggacctcg
accatcgccgccgactatctggggctcgaggatcgcggccggatcgtcgcgggcgcggtg
gccgatctggtcgtgctcgacgcctcgctcgacctccgggaggtcatcatgcgcgggcgc
cccatcggcggcagttga

DBGET integrated database retrieval system