KEGG   Roseitalea porphyridii: E0E05_01945Help
Entry
E0E05_01945       CDS       T05862                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
rpod  Roseitalea porphyridii
Brite
KEGG Orthology (KO) [BR:rpod00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    E0E05_01945 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: QBK29464
UniProt: A0A4P6UYT2
Position
396131..396523
Genome map
AA seq 130 aa AA seqDB search
MYRQTTEGIEVTVRPDFLDQESDPDEGRWFWAYTVVIANHSDETVQLESRYWRVTNALGE
VQEVSGPGVIGEQPVLSPGDSFQYTSGCPLNTPSGTMVGHYIMRRESGERMRALIPPFSL
DMPNIARTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgccagaccaccgaaggcatcgaagtgaccgtgcggccggacttcctcgaccag
gagtccgatccggacgaaggccgctggttttgggcctacaccgtcgtgatcgccaaccat
tccgacgagaccgtgcagctcgagagccgctactggcgcgtgaccaacgcgctcggcgag
gtgcaggaggtcagcgggcccggcgtgatcggcgagcaaccggtgctgtcgcccggcgac
agtttccagtacacctccggctgtccgctgaacacgccgtcgggcaccatggtcggccat
tacatcatgcgccgcgagagcggcgagcggatgcgtgcgctgatcccgccgttctcgctc
gacatgccgaacatcgcgcgcacgctgaactga

DBGET integrated database retrieval system