KEGG   Roseitalea porphyridii: E0E05_08330Help
Entry
E0E05_08330       CDS       T05862                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rpod  Roseitalea porphyridii
Pathway
rpod03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rpod00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    E0E05_08330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rpod03011]
    E0E05_08330
Ribosome [BR:rpod03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    E0E05_08330
  Bacteria
    E0E05_08330
  Archaea
    E0E05_08330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QBK30600
UniProt: A0A4P6V2E3
Position
1709419..1709802
Genome map
AA seq 127 aa AA seqDB search
MGKPKAERRLADNEARAVARMVRVSPQKLNLVAQMIRGKKVDAALADLEFSRKRIAGTVR
KTLESAIANAENNHDLDVDALVVSEAYVGKSIVMKRFHARGRGRASRIMKPFSHLTIVVR
EVQEEVA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagccgaaggcagaacggcggctggcggacaacgaagcccgcgctgtggcgcgg
atggtccgcgtcagcccgcagaaactcaatctggtcgcccagatgatccgcggcaagaag
gtcgacgcggcgctggccgatctcgaattctcgcgcaagcgcattgccggcaccgtccgc
aagacgctggaatcggcgatcgccaatgccgagaacaatcacgatctcgacgtcgacgcg
ctcgtcgtctcggaagcctatgtgggcaagtcgatcgtcatgaagcgcttccatgcgcgc
ggtcgcggccgggcgagccggatcatgaaaccgttctcgcacctgacgatcgtggtgcgt
gaagtccaagaggaggtcgcctga

DBGET integrated database retrieval system