KEGG   Roseitalea porphyridii: E0E05_15690Help
Entry
E0E05_15690       CDS       T05862                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rpod  Roseitalea porphyridii
Brite
KEGG Orthology (KO) [BR:rpod00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E0E05_15690
Enzymes [BR:rpod01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     E0E05_15690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: QBK31906
UniProt: A0A4P6V5M7
Position
3216493..3217338
Genome map
AA seq 281 aa AA seqDB search
MTMRVAAVQMRSGTDPTANVVSFTELVTEAADAGARYVQTPEMTGLVQKDRKALTGTVGA
QEDDPLLSAAGDLARTHGIWLHVGSTPILRGDGKVANRAVLFAPDGTLAATYDKIHMFDV
DLPNGESWRESAIYAPGDRFVVADVEGVGLGLAICYDLRFPALFADLARAGASVLTVPAA
FTRQTGEAHWHVLLRARAIENGAFVIAAAQGGTHEDGRETYGHSLIVDPWGAIIAEKADD
TPGVIVADIDPSASAAARGRIPNLANVRPYAQDRRQQDAAQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcgcgtcgccgccgtccagatgcgttcgggaaccgacccgaccgccaatgtc
gtctcgttcaccgaactggtcaccgaggcggccgatgcgggcgcccgctacgttcagaca
ccggaaatgacgggcctggtccagaaagaccgcaaggcgctgaccgggacggtcggcgcg
caggaggacgacccgctgctgtcggcggctggcgatctcgcccgtacccatggtatctgg
ctgcatgtcggctcgacgccgatcctgcggggcgacggcaaggtcgccaaccgggcagtc
cttttcgcgcccgacggcacgctggctgcgacctatgacaagatccacatgttcgacgtg
gacctgccgaacggcgaaagctggcgcgaatcagccatctacgcgccgggcgaccggttc
gtcgtcgccgacgtcgaaggcgtcgggctcggcctcgcgatctgctacgatttgcggttt
ccggccctgttcgccgatctggcccgcgccggcgcttccgttttgaccgtgccggccgcg
ttcacgcgccagaccggcgaggcgcactggcatgttctgctgcgggctcgcgccatcgag
aacggcgccttcgtcatcgccgccgcgcagggcggcactcacgaggacggacgcgagacc
tatggccattcactgatcgttgacccctggggcgcaatcatcgccgagaaggccgacgac
acgcccggcgtgatcgtcgccgacatcgatccgtccgcgtcggccgccgcgcgtggccgc
attcccaacctggccaacgtgcggccctatgcgcaggacaggcgacagcaggacgcggca
caatga

DBGET integrated database retrieval system