KEGG   Rickettsia parkeri: MC1_00710Help
Entry
MC1_00710         CDS       T01785                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00030  Pentose phosphate pathway
rpp00230  Purine metabolism
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
rpp01230  Biosynthesis of amino acids
Module
rpp_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MC1_00710
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MC1_00710
Enzymes [BR:rpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     MC1_00710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran Pribosyl_synth Pribosyltran_N UPRTase
Motif
Other DBs
NCBI-ProteinID: AFC74324
Position
126004..126495
Genome map
AA seq 163 aa AA seqDB search
MPYFGYARQDNINSQNIIPAKLIADFLEKLGVNHVITIDLHSDKIEKFFNIPVSNLEPIN
LYIPFSSTYSNFAIVTPDKGSINRVQKISNLLNIDSAYINKERDINNNCETITSSVEGKN
CILIDDIIDSGETIVKAARFLKEHSALSVSAFITHAVFSAGRF
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccttattttggttatgcaaggcaagataatataaattctcaaaatataattcctgct
aagttaatagcagattttttagagaagctcggagtaaaccatgtaattactattgattta
cactccgataaaatagaaaaattttttaatattcctgtttctaatcttgaacctataaat
ttatatatcccgttttcaagcacttatagcaatttcgctatagttacacctgataaagga
agtatcaatcgagttcaaaaaattagtaatttactaaatatagattcagcttatataaac
aaagaaagggatataaataataattgcgagacaatcacaagtagtgtagagggcaaaaat
tgcatattaattgatgatattatagatagtggagaaacaatcgtaaaagcagcgagattt
ttaaaagaacattcggctttatcggttagtgcttttataactcatgcagtgttttctgcc
ggccggttctaa

DBGET integrated database retrieval system