KEGG   Rickettsia parkeri: MC1_01935Help
Entry
MC1_01935         CDS       T01785                                 

Definition
(GenBank) pyruvate dehydrogenase e1 component, alpha subunit precursor
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00010  Glycolysis / Gluconeogenesis
rpp00020  Citrate cycle (TCA cycle)
rpp00620  Pyruvate metabolism
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
Module
rpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC1_01935
   00020 Citrate cycle (TCA cycle)
    MC1_01935
   00620 Pyruvate metabolism
    MC1_01935
Enzymes [BR:rpp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MC1_01935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AFC74541
Position
353366..354346
Genome map
AA seq 326 aa AA seqDB search
MDIKLGKYKPTKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQEAVISAVDM
VKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFNVPNKFYGGH
GIVGAQVPIGTGLAFAEKYNDTHNICFTFLGDGAVNQGQVYEAFNMAALWGLPVVYIIEN
NEYSMGTSVARSTFMRDLYKKGASFGIKGFQLDGMDFEEMYDGSKQAAEYVRENSFPLIL
EVKTYRYRGHSMSDPAKYRSKEEVEQYKERDPLVIIRKTILDNKYVTEADLKAIEQSVKE
IVKEAVEFSENSPLPDEGELYTQVYC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggatattaagttaggaaaatataagccgacaaaggaagaatatataaaaagctttaaa
gatatgctcctactgcgtcgttttgaagaaaaatgcggtcagttatacggaatgggagaa
atcggtggtttttgtcatttatatatagggcaagaagcagtaatttctgcggtagatatg
gttaaacaaaaaggtgatagcactattactagctatcgtgaccatgctcatattatttta
gcaggcactgagcctaagtatgttcttgccgagcttatggggcgtgctacaggttgctcg
aaaggtaagggtggctcgatgcatttatttaatgtaccaaacaaattttacggtggacac
ggtatagtaggggctcaagtaccaataggcacagggcttgcgtttgctgaaaaatataac
gatacgcataatatctgttttacttttttaggtgacggtgccgttaatcaaggtcaggta
tatgaagcttttaatatggctgctttatggggtttgccggtagtttatattattgaaaat
aacgaatattcgatggggacgtctgtagcacgttctacctttatgcgtgatttatataag
aaaggggcatcgtttgggattaaaggatttcagctagacggtatggattttgaagaaatg
tatgacggctctaagcaagcagccgagtatgttagagaaaatagctttcctctgatatta
gaggtaaaaacttatcgttatcgtgggcattcgatgtccgacccggcaaaatatcgtagt
aaagaagaagttgagcaatataaagagcgtgatccgttggtaataataagaaaaacgata
ctcgacaataaatatgtaaccgaagcggatttaaaagcaatagaacagtcggtaaaagaa
attgtgaaagaagcagtagaattctcagaaaattcaccgctccctgatgaaggggagttg
tatacacaggtgtactgttaa

KEGG   Rickettsia parkeri: MC1_01940Help
Entry
MC1_01940         CDS       T01785                                 

Definition
(GenBank) pyruvate dehydrogenase subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00010  Glycolysis / Gluconeogenesis
rpp00020  Citrate cycle (TCA cycle)
rpp00620  Pyruvate metabolism
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
Module
rpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC1_01940
   00020 Citrate cycle (TCA cycle)
    MC1_01940
   00620 Pyruvate metabolism
    MC1_01940
Enzymes [BR:rpp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MC1_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AFC74542
Position
354483..355463
Genome map
AA seq 326 aa AA seqDB search
MQITVREALRDAMQEEMIRDDKVFVIGEEVAEYQGAYKVTQGLLEQFGPQRVIDTPITEY
GFAGLAVGAAFAGLRPIVEFMTFNFAMQAFDHIVNSAAKTHYMSGGQVKCPIVFRGPNGA
ASRVAAQHSQNYTACYSHIPGLKVVVPYSAEDHKGLMLTAIRDDNPVVFLENEILYGHSF
DVPKTIEPIPFGQAKILREGSSVTIVTFSIQVKLALDAANVVQNDNIDCEVIDLRTIKPL
DTETIIESVKKTNRLVVVEEGWFFAGVGASIASIVMKEAFDYLDAPIEIVSGKDLPLPYA
VNLETLALPSESDVIEAVKKVYYYSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataacggtacgtgaagcattgcgtgatgccatgcaagaagagatgataagagac
gacaaggttttcgtcataggcgaggaagttgcagaatatcaaggagcttataaggtaact
caaggattactagagcaatttggtcctcagagggtaattgatacaccgataacggaatat
ggttttgcagggcttgcagtcggagcagcttttgcaggacttcgcccgatcgtagagttt
atgacctttaactttgctatgcaagcattcgatcacatagttaattcagctgcaaaaacg
cattacatgtcaggcgggcaggtcaaatgtccgatagtatttagaggaccaaacggagca
gcaagtagagtagctgcacaacatagccaaaattatacagcttgctattcccacattccg
ggattaaaagtagtagttccttatagtgcagaagatcataaaggacttatgcttacagct
attagggacgataatcccgttgtttttttagaaaatgaaattttatacggtcatagtttt
gacgtgccgaaaacaatcgagcctataccctttggtcaggcaaaaattttaagagagggt
agtagtgtcactatagtaactttctcgattcaagtaaaacttgccttagatgctgcaaat
gttgtgcagaatgataatattgattgtgaggttattgatcttcgcactattaaaccgctt
gatactgagacaataatagaatcagtgaaaaaaactaatcgtttagttgtagtggaagaa
gggtggttttttgcaggtgttggtgcaagtatagcttctattgttatgaaagaagcattt
gattatttagatgctccgatagagattgtaagcggcaaagatcttccccttccttatgct
gttaatttagaaacactagctctgccgagtgagagcgatgtaatagaagccgttaaaaag
gtttattattatagtatttaa

KEGG   Rickettsia parkeri: MC1_03885Help
Entry
MC1_03885         CDS       T01785                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00010  Glycolysis / Gluconeogenesis
rpp00020  Citrate cycle (TCA cycle)
rpp00620  Pyruvate metabolism
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
Module
rpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC1_03885
   00020 Citrate cycle (TCA cycle)
    MC1_03885
   00620 Pyruvate metabolism
    MC1_03885
Enzymes [BR:rpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MC1_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFC74878
Position
677252..678490
Genome map
AA seq 412 aa AA seqDB search
MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEEKTDINAFIAKNNSVSPSPKTDANLPKPHENIANVEEQ
VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR
NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKFFSEDKSTR
ISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKN
ILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGAS
AKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLMLI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcctggagaagtaattgctgaaattgaa
accgataaagcaacgatggaagtagaagcagtagacgaaggtatacttgccaaaatagtt
atcccacaaaatagtcaaaatgtacctgttaactctttaattgccgtgttaagtgaagag
ggagaagaaaaaacagacattaatgcgtttattgcaaaaaataatagtgtatcaccgtca
ccgaaaacagatgctaatcttccgaaaccccacgagaatatagctaatgtagaagaacag
gtaacagttataaaacatgatgctagtaaaatattcgcctcaccgcttgcaaaaagactt
gcaaaaatgagaaatattagatttgagagcgtgaaaggtagcggtccgcacggtagaata
gtcaaacaagatatcttatcatatactcctagcactgctcataataaaatagttagcaga
aatcctgaagaatatcgtttagtaccaaataataatatccgcaagattatagccaagcgt
ctgcttgaatctaaacaaacagttccacatttttatttatctatagaatgtaatgtcgat
aaattgttagatataagagaagacattaataaatttttttctgaagataaatcaacaagg
atatcggttaatgattttattattttagcagtagccaaagctttacaagaagtgccaaat
gccaatgctagctggggagaagatgcaattagatattacaataatgtcgatatttcagta
gcggtagcgattgagaacgggcttgttacaccgatagttaaaaatgccaatcaaaaaaac
attctagaactatctcgtgaaatgaaagcattaataaagaaagcaaaagataataaatta
acccctgaagaatttcagggcggagggtttaccatttctaacctcggtatgtacggtatt
aagaatttcaatgctataattaacccaccacaaagttgtataatgggcgtcggagctagt
gcaaaacgtgctatagtcaagaatgatcaaataactatagcaacaattatggacgtaact
ctttctgccgatcaccgagtagtagacggagcagtcggtgctgagttcttggcagcattt
aaaaagtttatagagagtcccgttttgatgttgatataa

KEGG   Rickettsia parkeri: MC1_04350Help
Entry
MC1_04350         CDS       T01785                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00010  Glycolysis / Gluconeogenesis
rpp00020  Citrate cycle (TCA cycle)
rpp00260  Glycine, serine and threonine metabolism
rpp00280  Valine, leucine and isoleucine degradation
rpp00310  Lysine degradation
rpp00380  Tryptophan metabolism
rpp00620  Pyruvate metabolism
rpp00630  Glyoxylate and dicarboxylate metabolism
rpp00640  Propanoate metabolism
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
Module
rpp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC1_04350
   00020 Citrate cycle (TCA cycle)
    MC1_04350
   00620 Pyruvate metabolism
    MC1_04350
   00630 Glyoxylate and dicarboxylate metabolism
    MC1_04350
   00640 Propanoate metabolism
    MC1_04350
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MC1_04350
   00280 Valine, leucine and isoleucine degradation
    MC1_04350
   00310 Lysine degradation
    MC1_04350
   00380 Tryptophan metabolism
    MC1_04350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpp04147]
    MC1_04350
Enzymes [BR:rpp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     MC1_04350
Exosome [BR:rpp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MC1_04350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored UDPG_MGDP_dh_N NAD_binding_8 AlaDh_PNT_C Lycopene_cycl K_oxygenase FAD_binding_3 3HCDH_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AFC74960
Position
complement(766922..768301)
Genome map
AA seq 459 aa AA seqDB search
MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKSDTLGGTCLNIGCIPSKVLLNSSEKY
EAALKHFENIGIIADVKLDLQKMLANKDKVVLDLTQGIESLFAKNKVTRIKGEAKISSSN
IVEVNKEQIKAKNILITTGSSIIEIPNIKIDEEFIVSSTGALKLSKVPENLIVVGGGYIG
LELGSVWRRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIEFKLNTKVLSAEVKSG
KVNLTIEEDGKSSVVTSDVVLMAVGRKAYTQNLGLESVGIITDKQGSIEINDRFQTAISN
IYAVGDVVKGAMLAHKAEEEAVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQL
KEKGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDRVLGAHIIGADAGTLIAALTA
YMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINM
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatttgatttagtggtaataggtagcggtccagccggttatacaggcagtatt
agggctgctcaacttggtatgaaagtagcgtgtattgagaaaagcgatactcttggcggc
acttgtttaaatataggatgcataccatcgaaagttttactgaattcttccgaaaaatat
gaagcagctctaaaacattttgagaatataggtattattgcggatgtaaaactagactta
caaaaaatgctagctaataaagataaagtagttcttgatctcacacaaggtatagaaagt
ctctttgccaaaaacaaagttactaggataaaaggtgaagctaaaattagctctagtaat
atcgttgaagtaaataaagagcaaattaaagccaaaaatatcctaattactacaggttcc
agcatcatagaaataccgaatatcaaaatagacgaagaatttattgtttcatctactggt
gctttgaaactttctaaagtacctgagaacttaatagtagttggcggagggtatataggc
ttagaacttggttcagtttggcgtcgtttgggagctaaagtaacggttattgagtatgca
ccgagcattgtacctatgcttgataaagaaattgctacacaatttatgaaactacagcaa
aaacaaggtatagagtttaaactgaatactaaagtgctatctgctgaagtaaagtcagga
aaagtaaatctaacaatagaggaggacggtaagagttcagtagtaacaagcgatgttgtg
ttgatggcggtaggcagaaaagcctatacgcaaaatctagggcttgagtctgtcggtatt
attacggataagcaaggtagcattgagattaatgaccggttccaaacagcaatttcaaat
atttatgcagtcggtgatgtggtaaaaggagctatgcttgctcataaagccgaggaagag
gctgtagctgccgtagaaattatggcagggcaggcaggacatgttaactataacttaatt
ccaagcgtaatatatacttatcctgaagtagcaagcgtcggtgaaacggaagaacagcta
aaagaaaaaggcattaattataaagtcggtaagtttccgtttttagcaaatagtagagca
agagcaatcggtagtacggaaggtatggttaagatccttgccgatagtaaaaccgatagg
gttttaggagctcatattataggagctgatgcaggtacattaattgccgcgcttacggct
tatatggaattcggagcagcttcagaagatatagcaagaacctgccacgctcacccaact
ttaagcgaggctataaaagaggcagcacttagtgtagataagaggactattaatatgtga

KEGG   Rickettsia parkeri: MC1_06830Help
Entry
MC1_06830         CDS       T01785                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00010  Glycolysis / Gluconeogenesis
rpp00020  Citrate cycle (TCA cycle)
rpp00260  Glycine, serine and threonine metabolism
rpp00280  Valine, leucine and isoleucine degradation
rpp00310  Lysine degradation
rpp00380  Tryptophan metabolism
rpp00620  Pyruvate metabolism
rpp00630  Glyoxylate and dicarboxylate metabolism
rpp00640  Propanoate metabolism
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
Module
rpp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC1_06830
   00020 Citrate cycle (TCA cycle)
    MC1_06830
   00620 Pyruvate metabolism
    MC1_06830
   00630 Glyoxylate and dicarboxylate metabolism
    MC1_06830
   00640 Propanoate metabolism
    MC1_06830
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MC1_06830
   00280 Valine, leucine and isoleucine degradation
    MC1_06830
   00310 Lysine degradation
    MC1_06830
   00380 Tryptophan metabolism
    MC1_06830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpp04147]
    MC1_06830
Enzymes [BR:rpp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     MC1_06830
Exosome [BR:rpp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MC1_06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 NAD_binding_8 HI0933_like FAD_oxidored GIDA FAD_binding_2 FAD_binding_3 DAO AlaDh_PNT_C 3HCDH_N K_oxygenase Lycopene_cycl Trp_halogenase 2-Hacid_dh_C Thi4
Motif
Other DBs
NCBI-ProteinID: AFC75389
Position
complement(1181286..1182665)
Genome map
AA seq 459 aa AA seqDB search
MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFE
YIKHAKDYGIDAKGAEINIKKIVARSREISNKLAGGVKLLLKKNKVTVIDGVASLAGNKV
ININDKPTVKAGNIIIATGARSRVLKGFEPDGKQIWTSKEAMIPQHVPKSMIIVGSGAIG
IEFASFYNSIGVDVTVIEAHNRILPAEDMEISGIAHKNFEKKGIKIITNAKLIKQTKSKD
KIEVELELADKTQKLQAEILLMAVGITANTENLGLEKTKIKVENGYITTNGLMQTAASGI
YAIGDVAGVPCLAHKASHEGIIAAESIAGLKPHTINKHNIPGCTYSSPQIASVGLTEEAA
TTLGYELKIGRFPFIANGKALVSGDSDGLIKTIFDAKTGELLGAHMIGSEVTELIQGYVV
SKNLEGTELDLINTIFPHPTLSEMMHESVFSAYDRAIHI
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatatgatgtagccgttataggcggtggtccaggtggatatgttgcagcaatt
agagcagcacaattaaagaaaaaagttgtattaatagaaaaagagcatttgggtggggta
tgtcttaattgggggtgtataccgactaaatccctgcttaaatctgctgaggtttttgaa
tatataaaacatgctaaagattatggaattgatgctaaaggtgctgaaatcaacattaag
aaaatagtcgcacgctcaagagagatttcaaataagcttgcaggcggtgttaagttacta
ctgaaaaaaaacaaagtgaccgtgatagacggagtagcaagtcttgcaggaaataaggta
ataaatataaatgataaacctacagtaaaagcaggaaatattattatagctaccggcgca
agatctagggttttaaaaggctttgagcctgacggtaaacaaatttggacttctaaagaa
gctatgataccgcagcatgtgccgaaatctatgattattgtcggctcaggtgcaatcggt
atagaattcgcttcgttttataatagtattggtgtggatgttaccgtaattgaggcacat
aatagaatattgcctgctgaagatatggaaattagcggaatcgctcataagaactttgag
aagaaaggtataaaaattattacaaatgctaagttaattaagcaaacaaaatcaaaagat
aagatagaagttgagttagagttagcagataaaacacaaaaattacaagctgaaatttta
cttatggcagtaggtattacagctaatacggaaaatttaggtcttgagaaaacaaaaatt
aaagtagaaaacggctatataactactaacgggttaatgcaaactgcggcatcaggaatt
tatgctataggcgatgtagcaggagtgccttgtttagctcataaagcaagccatgaaggt
attattgcagcggaaagcatagcgggcttaaaaccgcatactattaataaacataatatt
cctggttgcacttattcttcgccgcaaatagcaagcgtcggtttgactgaagaagcagca
acaaccttaggttatgaacttaaaataggcagatttccttttatagctaacggtaaggct
ttagtaagcggtgatagcgatggtttaattaaaactatatttgatgctaagacgggtgag
ttgcttggagctcatatgataggttcggaagttacggaattaatacaaggatatgtggtt
tcaaaaaatttagaaggaacggagttggatttaattaacactatcttcccgcatccgact
ttatcggaaatgatgcatgaatcagtattctctgcttatgatagggcaatacatatataa

DBGET integrated database retrieval system