KEGG   Rickettsia parkeri: MC1_02265Help
Entry
MC1_02265         CDS       T01785                                 

Definition
(GenBank) ribose-5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00030  Pentose phosphate pathway
rpp00051  Fructose and mannose metabolism
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
rpp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MC1_02265
   00051 Fructose and mannose metabolism
    MC1_02265
Enzymes [BR:rpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MC1_02265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: AFC74599
Position
complement(407082..407516)
Genome map
AA seq 144 aa AA seqDB search
MKTYNIVIASDHSGYELKSEIINYLEQKSLKIYDCGTNNTQTVDYPDYAKKVVDIIIEKS
APIGILISDTGIGMSIAANRSSEIRAALCNNILTAENAKAHNDANILILGAKTIDQKIVY
DIIDKFLTTQFEGGRHSTRLSKIK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttataatattgtcatagctagtgatcattcaggttatgagcttaagtctgaa
attatcaattatttagagcagaaatctctaaagatttatgactgcggaacaaataataca
caaaccgttgattatcctgattatgctaagaaagtagtagatattattattgaaaaatca
gcacctatcggtattttaattagtgatacggggattggtatgtctatagctgcgaatcgt
agctcggaaataagagccgctttgtgcaacaatatattaactgccgaaaatgctaaagct
cataatgacgctaatatcttgatactcggagcaaaaaccatagaccaaaaaatagtatat
gatattatagataagtttttaactacccaatttgaaggcggcagacatagcacccgccta
tcaaagataaaatag

DBGET integrated database retrieval system