KEGG   Rickettsia parkeri: MC1_03150Help
Entry
MC1_03150         CDS       T01785                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00471  D-Glutamine and D-glutamate metabolism
rpp00550  Peptidoglycan biosynthesis
rpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MC1_03150 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MC1_03150 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpp01011]
    MC1_03150 (murD)
Enzymes [BR:rpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     MC1_03150 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:rpp01011]
 Precursor biosynthesis
  Amino acid ligase
   MC1_03150 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Endonuc_subdom
Motif
Other DBs
NCBI-ProteinID: AFC74758
Position
556197..557699
Genome map
AA seq 500 aa AA seqDB search
MNSHTKQKIGVFGLGKTGISVYEELQNKYDVIVYDDLKANRDIFEELYSKTAIAALSDSR
WQNLDTIVLSPGIPLTHEIVNIAKSFNIPITSDIDLLFAKSKNLKFIAITGTNGKSTTTA
LISHILNSSGLDYPVAGNIGVSALQAKASKDGYVLELSSFQLDLVKTFTAKIAVLLNITP
DHLDRHQDMTCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIKLQQEQRIKLIPFSVAQ
ILENGISVVDDKIRANFFDDISFELQHNSESFRQDEFQGEPAEPECIKIREHRQDLQNSL
VSSFMHYAVPFNKNLQGVHNCENIAASYAVAKIIGVEPKKILESISSFQSLPHRMQYIGS
INNISFYNDSKATNAISAVQSIKALDNIYWLAGGIPKEGGIEEIKPYFSHIKKAYFYGQA
KEIFANTAKNIVDFVICDNLEQAFDLAYKDAVGDNAEVKNILLAPSCSSYDQFKNFEERG
ELFIKLCSILSLRGLTTGSS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaattctcatacaaaacaaaaaataggtgtttttgggcttggtaaaaccggtatatcg
gtttacgaggaattgcaaaataaatatgatgtaattgtttatgatgatttaaaagcaaat
agagatatatttgaagaattatatagtaaaaccgctatcgctgctttatctgattcaaga
tggcaaaatttagatacaattgtcttaagtcctggaattcctttaacgcatgagatagtc
aatattgcaaaaagttttaatattccaatcacttctgatatagacttattatttgcaaaa
tcaaaaaacttaaaatttatagctataaccggtacaaacggtaaaagtactactactgct
ttaataagccatatcttaaatagtagcggtttagactatccggttgccggtaatattgga
gtttctgctttgcaagctaaagcaagtaaggatggatatgtacttgaattgtcttctttt
cagctagatctagtaaaaacctttacagctaaaatagccgtgcttcttaatataactccc
gaccatttagatagacatcaggatatgacctgctatattgccgcaaaatctaagatcttt
gatcgaatggatcaagagagttatgcggtaattaatatcgataatgattattgtcgtgaa
gtctttataaaattgcagcaagagcagcgtataaagctaattcctttttcggttgctcaa
attcttgaaaacggtatttcggtagttgatgataaaattagagctaatttttttgatgat
ataagttttgaattacagcataattcagaaagttttagacaagatgaatttcaaggtgag
cctgcggagccggagtgtataaaaatacgtgagcacaggcaagacctgcaaaattcgctt
gtatcaagctttatgcattatgctgtaccttttaataaaaacctgcaaggagttcataat
tgtgagaatattgcagcaagttatgcagtagctaaaataataggagtagaacctaaaaaa
atacttgaatctataagtagttttcaaagtttacctcatagaatgcaatatatcggtagt
ataaataatataagtttttacaatgatagtaaagcgacaaatgccatatctgccgtgcaa
tcaattaaagcactcgataatatttactggcttgcgggaggaattcctaaagagggtggt
attgaggaaataaagccttatttcagtcacattaagaaagcttatttttatggtcaagct
aaagaaatatttgcaaatactgctaagaatatagtagattttgtaatatgtgataatctt
gagcaggctttcgatcttgcttataaggatgcagtaggtgataacgcggaggtaaaaaat
atcttgttagcacctagttgtagctcatatgatcagtttaaaaattttgaagagcgtggc
gagttgtttataaaattgtgtagtatcctgtcactccgtggcttgaccacggggtctagt
taa

DBGET integrated database retrieval system