KEGG   Rickettsia parkeri: MC1_04505Help
Entry
MC1_04505         CDS       T01785                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00130  Ubiquinone and other terpenoid-quinone biosynthesis
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MC1_04505
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MC1_04505
Enzymes [BR:rpp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     MC1_04505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AFC74987
Position
791039..791614
Genome map
AA seq 191 aa AA seqDB search
MNKETKIVIAISGASGAIYGIRLLEVLKQQNIETHLVISEGAALTIKLETKYSIDTVKLL
ANYYYDDKDLGATISSGSFKTSGMIIAPCSMKTLASLAHSMEDNLISRAAGVVLKDRRKL
ILMTRETPLHIGHLENMLKVASYGGIISPPVPAFYNNPVSIDDIVNHSITRVLDFFDIET
NLIKRWDSYEQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaaacaaaaattgttatagcaatttctggagcttcaggagcaatatacggt
attcgtttgcttgaagtactaaagcaacaaaatatcgaaactcatttggttatttcagaa
ggagcagctcttactataaagctcgaaactaaatattctatagatacagttaaactactg
gctaattattattatgacgataaagatttaggtgctactatttcaagcggctcttttaaa
acttcaggcatgataatagccccttgtagtatgaagaccttagcaagtcttgctcactca
atggaagataatttaattagtagagcggcaggtgttgtacttaaagacagaaggaaactt
attttaatgacccgtgaaactcctttgcatatcggacatttagaaaatatgttaaaagta
gcgagttacggcggcattatatcgccgcccgtgccggctttttataataaccctgtaagt
atagatgatatagtgaatcattctattactagagttttagattttttcgatatcgaaact
aatttaattaaacgctgggatagttatgagcaataa

DBGET integrated database retrieval system