KEGG   Rickettsia parkeri: MC1_06330Help
Entry
MC1_06330         CDS       T01785                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00071  Fatty acid degradation
rpp00072  Synthesis and degradation of ketone bodies
rpp00280  Valine, leucine and isoleucine degradation
rpp00310  Lysine degradation
rpp00362  Benzoate degradation
rpp00380  Tryptophan metabolism
rpp00620  Pyruvate metabolism
rpp00630  Glyoxylate and dicarboxylate metabolism
rpp00640  Propanoate metabolism
rpp00650  Butanoate metabolism
rpp00900  Terpenoid backbone biosynthesis
rpp01100  Metabolic pathways
rpp01110  Biosynthesis of secondary metabolites
rpp01120  Microbial metabolism in diverse environments
rpp01130  Biosynthesis of antibiotics
rpp01200  Carbon metabolism
rpp01212  Fatty acid metabolism
rpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC1_06330
   00630 Glyoxylate and dicarboxylate metabolism
    MC1_06330
   00640 Propanoate metabolism
    MC1_06330
   00650 Butanoate metabolism
    MC1_06330
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC1_06330
   00072 Synthesis and degradation of ketone bodies
    MC1_06330
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC1_06330
   00310 Lysine degradation
    MC1_06330
   00380 Tryptophan metabolism
    MC1_06330
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC1_06330
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC1_06330
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC1_06330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpp04147]
    MC1_06330
Enzymes [BR:rpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC1_06330
Exosome [BR:rpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC1_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC75301
Position
complement(1082922..1084016)
Genome map
AA seq 364 aa AA seqDB search
MLAAHLIKDILQNSKIDPALVGEVILGQVITGGSGQNPARQTLIYAGIPKEVPGYTINKV
CGSGLKSVVLAANSIMMGDNEIVIAGGQENMSLCMHGSYIRAGAKFGDIKMVDLMQYDGL
TDVFSGVFMGITAENISKQFNISRQQQDEFALSSHKKAAKAQLAGVFKDEILPVEVTIKK
TTSLFDHDGTVRPDISLEILSKLRPAFDKNGVVTADNASSINDGAACLMVVSEEVLKKHN
LTPLARIVSYASAGVDPSIMGTAPVPASKKALSKAGWSVNDLEVIEVNEAFAAQSIYVNR
EMKWDMEKVNVNGGAIAIGHPIGASGGRVLITLIHGLRRAKAKKGLVTLCIGGGMGMAMC
VEAV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgctcatttaataaaggatatactgcaaaacagcaaaatcgatccagcttta
gtaggtgaggtaatccttggacaggtaataaccggcggtagcgggcagaatccggcgagg
caaactctgatttatgcgggaataccgaaagaagtgccgggctatacgattaataaagta
tgcggctcaggtcttaaaagcgtagtacttgcagcaaattcaattatgatgggtgataat
gaaatagttatagcaggtgggcaggagaatatgtcgctctgtatgcacggtagctatatc
agagcaggagctaaattcggcgatattaaaatggttgatctaatgcagtatgacggatta
accgatgtattttcaggagtatttatgggtattacagccgaaaatatctcgaaacagttt
aatattagcagacaacagcaggacgagtttgccttaagctctcacaagaaagcagctaaa
gcacagctagcaggagtttttaaagatgaaatcttacctgtcgaagtaacgattaaaaaa
actactagtttgtttgatcatgatggaacagtaagacctgatatcagccttgaaattctg
agtaaattacgtcctgcttttgataaaaacggtgtagttacagcggataatgcttcctct
attaatgatggtgcggcatgtcttatggtagtttccgaagaagttttgaaaaagcataat
ttaacgccgctagctcgtattgtttcttatgcttcagccggtgttgatccaagtattatg
ggtactgcccctgttcctgcatccaaaaaagctttaagtaaagcaggttggagcgttaat
gatttggaagttatcgaggttaatgaggcgtttgccgctcaaagtatttatgtaaaccgt
gaaatgaaatgggatatggagaaggttaatgttaacggtggagcaatagccatcggtcat
ccgatcggggcaagcggcggacgtgtacttattactctgatacacggcttacgcagagct
aaagctaaaaaaggcttagttactttatgtatcggtggcggtatgggtatggctatgtgc
gttgaagcggtttaa

DBGET integrated database retrieval system