KEGG   Rickettsia prowazekii Rp22: rpr22_CDS121Help
Entry
rpr22_CDS121      CDS       T01977                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
rpq00020  Citrate cycle (TCA cycle)
rpq00190  Oxidative phosphorylation
rpq00650  Butanoate metabolism
rpq01100  Metabolic pathways
rpq01110  Biosynthesis of secondary metabolites
rpq01120  Microbial metabolism in diverse environments
rpq01130  Biosynthesis of antibiotics
rpq01200  Carbon metabolism
Module
rpq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    rpr22_CDS121 (sdhD)
   00650 Butanoate metabolism
    rpr22_CDS121 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    rpr22_CDS121 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS PAP2 Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ADE29635
UniProt: D5AW46
Position
149913..150290
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA
IFYSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaagctaaaaatagcagtttttctaaaagt
ggttcgcatcattggttattgcaaagagtaactggtgtgatattagctttatgttctttt
tggttaatatattttatgttcaccaacaaaaataatgatataaatattattatgtgggaa
tttaaaaagccttttaatatagtaattttattaattaccgttactatttcattgtatcat
tcagtactcgggatgcgtgtagtaattgaggactatataaattgccacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtatcttttgtagtagcg
atattttatagtggataa

DBGET integrated database retrieval system