KEGG   Rickettsia prowazekii Rp22: rpr22_CDS717Help
Entry
rpr22_CDS717      CDS       T01977                                 

Gene name
paaJ
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpq  Rickettsia prowazekii Rp22
Pathway
rpq00071  Fatty acid degradation
rpq00280  Valine, leucine and isoleucine degradation
rpq00310  Lysine degradation
rpq00362  Benzoate degradation
rpq00380  Tryptophan metabolism
rpq00620  Pyruvate metabolism
rpq00630  Glyoxylate and dicarboxylate metabolism
rpq00640  Propanoate metabolism
rpq00650  Butanoate metabolism
rpq00900  Terpenoid backbone biosynthesis
rpq01100  Metabolic pathways
rpq01110  Biosynthesis of secondary metabolites
rpq01120  Microbial metabolism in diverse environments
rpq01130  Biosynthesis of antibiotics
rpq01200  Carbon metabolism
rpq01212  Fatty acid metabolism
rpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    rpr22_CDS717 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    rpr22_CDS717 (paaJ)
   00640 Propanoate metabolism
    rpr22_CDS717 (paaJ)
   00650 Butanoate metabolism
    rpr22_CDS717 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    rpr22_CDS717 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    rpr22_CDS717 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    rpr22_CDS717 (paaJ)
   00310 Lysine degradation
    rpr22_CDS717 (paaJ)
   00380 Tryptophan metabolism
    rpr22_CDS717 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    rpr22_CDS717 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    rpr22_CDS717 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    rpr22_CDS717 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpq04147]
    rpr22_CDS717 (paaJ)
Enzymes [BR:rpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     rpr22_CDS717 (paaJ)
Exosome [BR:rpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   rpr22_CDS717 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: ADE30293
UniProt: D5AY04
Position
complement(924255..925433)
Genome map
AA seq 392 aa AA seqDB search
MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITG
GSGQNPARQTLIYADIPQEVPGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMS
LGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDAFAL
SSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRHNTSIEILSKLRPAFDKNGV
VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLIT
LIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtcttagtacaattccagcaccaatgttagctgcttatttaatcaaggatatactgcaa
aatagtaaaatcgagcctgctttagtaaatgaggtaatacttggacaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgccgatataccgcaagaagtt
ccaggttatactattaataaagtatgtggctcaggtcttaaaagtatagcacttgcagca
aattcaattattacatgcgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggatctaaattcggcgatatcaaaatggtt
gatctcatgcaatatgatggtttaatagatgtattttcaggagtatttatgggtattact
gccgaaaatatcgcgaagcagtttaatattagtcggcaagagcaggacgcattcgcctta
agttctcacaagaaagctgctaaagcacaattatcaggaattctacaagatgaaatcttg
cctatagaggtaacagtaaaaaaaaatactagtttgtttgatcatgatgaaacagtaaga
cataatacaagcattgaaattcttagtaaattacgccctgcttttgataaaaatggtgta
gttacagctggtaactcttcctctattaatgacggtgcagcatgtgttctgcttgtttca
gaaaaagctttgaagaaacataatttaacaccgttagcgcgtattgtttcttgggcttca
gctggtgttgatccaagaattatgggtactgcacctgtacctgcatctaaaaaagcatta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgca
gcacaaagtatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagtggtggacgtcttcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtattggtatttctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system