KEGG   Rickettsia prowazekii Madrid E: RP765
Entry
RP765             CDS       T00018                                 
Symbol
RP765
Name
(GenBank) GUANYLATE KINASE (gmk)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
rpr00230  Purine metabolism
rpr01100  Metabolic pathways
rpr01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:rpr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RP765 (RP765)
Enzymes [BR:rpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RP765 (RP765)
SSDB
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 RNA_helicase CPT AAA RsgA_GTPase
Other DBs
NCBI-ProteinID: CAA15193
UniProt: Q9ZCH7
Position
complement(958122..958715)
AA seq 197 aa
MKFKNKGLIIILSSPSGTGKSSLAKELLKIDNNLRLSISVTTRKPRLGEVDGINYYFKSD
REFKTLVKQNKFLEYAKIYNDYYGTPKEYVKMLLKQGFDVLFDIDWQGVRSIKKNTNNVI
TIFILPPSIEILEQRLRNRATDNEETIKLRMQSAQNEISHANEYDYVVINDDFSQTLKKI
HEIIVAERAKNFAYHEY
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaaattcaaaaataaaggactgattataattttatcttctccttcaggtactggtaag
tcaagtttagctaaagaattattgaaaatagataataatttacgtttatctatttcagtc
actacaaggaaaccacgtttaggagaagtagatggtataaactattactttaaaagtgat
cgagagtttaaaacattagttaaacagaataaattccttgaatatgctaaaatatacaat
gattattatggtactcctaaagaatatgttaaaatgttattaaagcaaggctttgatgtt
ttattcgatattgattggcaaggagtcaggagtattaagaaaaatactaataatgttatt
actatatttatattgcctcctagtattgaaatactggaacaacgcttaagaaatagagcg
acagataatgaagaaacaatcaaattgcgtatgcagtcggcacaaaatgaaatatcgcac
gctaatgagtatgactatgtagttattaacgatgatttcagtcaaacgcttaaaaaaata
catgagattatagttgcagaaagagcaaagaattttgcttaccatgaatattag

DBGET integrated database retrieval system