KEGG   Rickettsia prowazekii Madrid E: RP053Help
Entry
RP053             CDS       T00018                                 

Definition
(RefSeq) ADP,ATP carrier protein
  KO
K03301  ATP:ADP antiporter, AAA family
Organism
rpr  Rickettsia prowazekii Madrid E
Brite
KEGG Orthology (KO) [BR:rpr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RP053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TLC
Motif
Other DBs
NCBI-GeneID: 883599
NCBI-ProteinID: NP_220447
UniProt: P19568
Position
59296..60792
Genome map
AA seq 498 aa AA seqDB search
MSTSKSENYLSELRKIIWPIEQYENKKFLPLAFMMFCILLNYSTLRSIKDGFVVTDIGTE
SISFLKTYIVLPSAVIAMIIYVKLCDILKQENVFYVITSFFLGYFALFAFVLYPYPDLVH
PDHKTIESLSLAYPNFKWFIKIVGKWSFASFYTIAELWGTMMLSLLFWQFANQITKIAEA
KRFYSMFGLLANLALPVTSVVIGYFLHEKTQIVAEHLKFVPLFVIMITSSFLIILTYRWM
NKNVLTDPRLYDPALVKEKKTKAKLSFIESLKMIFTSKYVGYIALLIIAYGVSVNLVEGV
WKSKVKELYPTKEAYTIYMGQFQFYQGWVAIAFMLIGSNILRKVSWLTAAMITPLMMFIT
GAAFFSFIFFDSVIAMNLTGILASSPLTLAVMIGMIQNVLSKGVKYSLFDATKNMAYIPL
DKDLRVKGQAAVEVIGGRLGKSGGAIIQSTFFILFPVFGFIEATPYFASIFFIIVILWIF
AVKGLNKEYQVLVNKNEK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtacttccaaaagtgaaaattatctttcagaactaagaaagataatttggcctata
gaacaatatgaaaataagaagtttttgccacttgcatttatgatgttctgtattttatta
aactactcaactcttcgttcaattaaagacggttttgtagtaacagatataggtacagaa
tcgataagttttttaaaaacatatatagtactaccttctgctgtaattgctatgataatt
tatgttaagctatgtgatattttaaagcaagaaaacgtattttatgttattacttcattt
tttttagggtattttgcattatttgcctttgttctttacccatatcctgatttagtccac
cctgatcataaaactatagaatctttaagtttagcttatcctaatttcaaatggtttata
aaaatagttggtaaatggagttttgcatctttttatactattgccgagctttggggaaca
atgatgcttagtttattattttggcaatttgctaatcaaattactaaaatcgctgaagct
aaacgtttctactcaatgtttggtttacttgcgaatttagcattgcctgtaacatcagtg
gttattggatattttctacacgaaaaaactcaaatagttgcagaacatttaaaatttgta
cctttatttgttataatgataacaagtagtttcttaataatattaacatatagatggatg
aataaaaatgttctaactgatcctagactatatgatccagcattagtaaaagaaaaaaaa
actaaagctaaattgtcgttcatagaaagtttaaaaatgatctttacttcgaaatatgta
ggttatattgcattattaattattgcttatggtgtttcagtaaatttagttgaaggtgtt
tggaaatccaaagtaaaagaattatatccgacaaaggaggcttataccatatatatgggt
cagttccaattttatcagggttgggttgcaattgcttttatgctgataggtagtaatatt
ttaagaaaagtatcatggctaactgcagctatgatcactccattaatgatgttcataaca
ggtgcggcatttttttcatttatattttttgatagcgttattgcaatgaatttaaccggc
atccttgcttcaagtcctttaacacttgctgttatgatcggtatgattcaaaatgtttta
agtaaaggtgtgaaatattctttatttgatgcaactaaaaatatggcgtatattccactt
gataaggatttacgagtcaaagggcaagctgccgttgaagttatcggaggaaggctcggt
aaatcaggcggtgctattattcaatctacattctttattttatttcctgtatttggtttt
atagaggcgactccttattttgcttctatattctttataatagtaatattatggatattt
gcagttaaaggtttaaataaagagtatcaagttttggtaaataaaaatgaaaaatag

DBGET integrated database retrieval system