KEGG   Rickettsia prowazekii Madrid E: RP167Help
Entry
RP167             CDS       T00018                                 

Definition
(RefSeq) hypothetical protein
Organism
rpr  Rickettsia prowazekii Madrid E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1674
Motif
Other DBs
NCBI-GeneID: 883853
NCBI-ProteinID: NP_220557
UniProt: Q9ZDZ6
Position
complement(197229..197465)
Genome map
AA seq 78 aa AA seqDB search
MLSNSLCPRLTNSLILSKLILVYQLFIFTGALIMDKQKVNNNIVEEENLSKEKEIGGIKG
LEPTRYGDWQHKGKVTDF
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
gtgttaagtaactccttatgtcctcgacttacaaactctttgatcctttccaagttgatt
ttggtatatcaactcttcatcttcacaggagctttaattatggacaagcaaaaagttaat
aataatatagtagaagaagaaaatttatcaaaagaaaaagaaattggtggtattaaaggt
ctagaaccaacaagatatggagactggcaacataaaggtaaagttacggatttttga

DBGET integrated database retrieval system