KEGG   Rickettsia prowazekii Madrid E: RP350Help
Entry
RP350             CDS       T00018                                 

Gene name
xseB
Definition
(RefSeq) exodeoxyribonuclease VII small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
rpr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rpr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    RP350 (xseB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rpr03400]
    RP350 (xseB)
Enzymes [BR:rpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     RP350 (xseB)
DNA repair and recombination proteins [BR:rpr03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     RP350 (xseB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_S HU-CCDC81_bac_2 Rho_Binding
Motif
Other DBs
NCBI-GeneID: 883397
NCBI-ProteinID: NP_220733
UniProt: Q9ZDH8
Position
431735..431977
Genome map
AA seq 80 aa AA seqDB search
MTNTKTLKDNISFEEALRELEEIVKKIDTGQENLETAVNSFERGILLKNHCEKKLKEARL
KIEKITKLADSTVILEETEV
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgactaatactaaaactttaaaagacaatattagctttgaagaagctttaagagagctt
gaggaaattgtaaaaaaaatagatactggacaagagaatctagagacggcagttaatagt
tttgaaaggggtattttacttaagaatcattgtgaaaaaaaattaaaagaagctcgatta
aaaattgaaaaaattactaaacttgctgattctacagtgatcttagaagagacagaagtg
tag

DBGET integrated database retrieval system