KEGG   Rickettsia prowazekii Madrid E: RP560Help
Entry
RP560             CDS       T00018                                 

Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
rpr00071  Fatty acid degradation
rpr00280  Valine, leucine and isoleucine degradation
rpr00281  Geraniol degradation
rpr00310  Lysine degradation
rpr00362  Benzoate degradation
rpr00380  Tryptophan metabolism
rpr00640  Propanoate metabolism
rpr00650  Butanoate metabolism
rpr00903  Limonene and pinene degradation
rpr00930  Caprolactam degradation
rpr01040  Biosynthesis of unsaturated fatty acids
rpr01100  Metabolic pathways
rpr01110  Biosynthesis of secondary metabolites
rpr01120  Microbial metabolism in diverse environments
rpr01130  Biosynthesis of antibiotics
rpr01200  Carbon metabolism
rpr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RP560
   00650 Butanoate metabolism
    RP560
  Lipid metabolism
   00071 Fatty acid degradation
    RP560
   01040 Biosynthesis of unsaturated fatty acids
    RP560
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RP560
   00310 Lysine degradation
    RP560
   00380 Tryptophan metabolism
    RP560
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RP560
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RP560
   00281 Geraniol degradation
    RP560
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RP560
   00930 Caprolactam degradation
    RP560
Enzymes [BR:rpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RP560
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RP560
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RP560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_2 ECH_1 NAD_Gly3P_dh_N NAD_binding_2 UDPG_MGDP_dh_N ApbA NAD_binding_8 Pyr_redox_2 DAO F420_oxidored Epsilon_antitox
Motif
Other DBs
NCBI-GeneID: 883251
NCBI-ProteinID: NP_220931
UniProt: Q9ZCZ1
Position
complement(698725..700887)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHQVVLLDILDKDSNDPNKIVKNSVKNLHKQKL
SPLSFPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLEIKHQLYNKIIPYLKEDAIIAS
NTSTLPLKKLKVNLPNNIKSRFVITHFFNPPRYMELVELIIDHTIKDEVIEKVSVFLTKM
LGKTIIKCNDTPGFIANRVGCFLLELVVHKAIAQNLNFVTIDQIFSRCLGLPNTGIFGLY
DLIGHDVMKLISSSLISALPKSDDYHRIYTNTKVFDKMIEHNLIGRKGEGGFYRLSVSNG
KKIKEVINISDLSYHPVQKVDISFNSLNELLSSNSIYGKFFSEIITEFYIYLTSLVPSVT
NNIYDIDTTMKLGYSWHYGPFELLTIAVKNGWNLIIKNADLMNIPLPKYLASKEYQKIDK
QKFNSKKDFLQESKIVLSNDSANLIHYCENLVFVITTKMNSLNHNVFYLLQEAVSKAENY
GKNLYIYPQGNNFSAGADLKLILSYIQDGNFHNLENLLKLGQQTMRYLKYSSVHIISCAR
GVALGGGCELLLNSSYIVANQELNAGLIELGVGLIPGWTGVTEMFARSNGNKTKLIRNIK
NIIEQNKTSSADYFKADYGIKNMQVNMNKHYILDDALKLRISKKIVSIPNKITLPKINIV
SEIDTSKYNELQNKVLNKFQNIIDKHNEISEAELLTYEREMFLELAKTPQTIEKLQAIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttattggtgcaggagtcatgggttcaggcatt
gcagcgttgattgctaattcctctcatcaagtagttctgcttgatattcttgataaagat
tctaatgatcctaataaaatagtaaaaaattctgtaaagaatttgcataaacaaaagctt
tctcctttatcttttccagataaagtcaatttcattacaataggtaatttagaacatgat
ttagatttaattaaagaatgtaatttagtaattgaagttatcgttgagaagttagaaatc
aaacatcaattatataataaaattataccttatcttaaagaagacgcaattatcgcttct
aacacctctacattgccgctaaaaaaactcaaagtgaatttaccaaataatataaagtca
agattcgttattacacatttctttaatccaccgcgatatatggaattggttgaattaatt
atagaccatacaatcaaggatgaggtcatagaaaaagtatcagtgttcttaactaaaatg
cttggtaaaactataataaaatgtaatgatacacctggttttattgctaatagagtagga
tgttttttacttgagttagtagtccacaaagcgatagctcaaaatcttaattttgttaca
atagatcaaatattcagtagatgtttaggtttgccgaataccggaatttttggtttatat
gatttaataggtcatgacgtaatgaagttgatatcaagttcattaatttctgctttacct
aaaagtgatgattatcataggatatatactaataccaaagtgtttgataagatgatagag
cataatttaattggacgtaaaggtgagggtggattttatcgtttatctgtatcaaatggt
aagaagattaaagaagtgattaatataagtgatttatcatatcaccctgttcaaaaagta
gatatttcgtttaatagtctcaatgagttgctatctagcaattcaatttatggtaagttt
tttagtgagattattacagaattttatatttatttaacaagcttagtaccatccgtgact
aataatatctacgatatcgataccactatgaagcttggttatagttggcattatggaccg
tttgagttattgactatagctgttaaaaatggatggaatttgataattaaaaatgctgat
ttaatgaatattccactgcctaaatatttagctagtaaagaatatcaaaaaattgataaa
caaaaatttaattctaaaaaagattttttacaagaaagtaaaatagtattatcgaatgat
tctgcaaatttaatacattattgtgagaatttagtatttgttattactacgaaaatgaat
agtttaaatcataacgtattttacttattgcaagaagccgtaagtaaagcagaaaattat
ggaaaaaatctttatatttatccacaaggaaataatttttctgcaggtgcggatttaaag
cttattctttcttatattcaagatgggaattttcataatttagagaatttactaaagctt
ggacaacaaacaatgcgttatttaaaatattcttcggtacatattattagctgtgctcgt
ggtgttgcacttggaggcgggtgtgaacttctattgaactcaagctatattgtagcaaat
caggagcttaatgctggacttatagagcttggagtaggtttaataccaggatggaccggt
gttacagaaatgtttgcccgaagtaatggaaataaaactaaattaattagaaatattaag
aatattatagagcaaaataaaacaagttcagctgattattttaaagcagattatggtata
aagaatatgcaagtcaatatgaacaagcattatattttagatgacgctttgaaactcaga
atatctaaaaaaatagtctccataccgaataaaattactttacctaaaattaatatagtt
agtgaaatagatacatcaaaatataacgagctacaaaataaggtacttaataaatttcag
aatattattgataaacataatgaaataagtgaagcagaattactgacatatgagcgtgaa
atgtttttagaacttgcaaaaacaccacaaactatagagaaattgcaagcgattgtgggg
taa

DBGET integrated database retrieval system