KEGG   Rickettsia prowazekii Madrid E: RP737Help
Entry
RP737             CDS       T00018                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
rpr00071  Fatty acid degradation
rpr00280  Valine, leucine and isoleucine degradation
rpr00310  Lysine degradation
rpr00362  Benzoate degradation
rpr00380  Tryptophan metabolism
rpr00620  Pyruvate metabolism
rpr00630  Glyoxylate and dicarboxylate metabolism
rpr00640  Propanoate metabolism
rpr00650  Butanoate metabolism
rpr00900  Terpenoid backbone biosynthesis
rpr01100  Metabolic pathways
rpr01110  Biosynthesis of secondary metabolites
rpr01120  Microbial metabolism in diverse environments
rpr01130  Biosynthesis of antibiotics
rpr01200  Carbon metabolism
rpr01212  Fatty acid metabolism
rpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RP737
   00630 Glyoxylate and dicarboxylate metabolism
    RP737
   00640 Propanoate metabolism
    RP737
   00650 Butanoate metabolism
    RP737
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RP737
   00072 Synthesis and degradation of ketone bodies
    RP737
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RP737
   00310 Lysine degradation
    RP737
   00380 Tryptophan metabolism
    RP737
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RP737
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RP737
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RP737
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpr04147]
    RP737
Enzymes [BR:rpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RP737
Exosome [BR:rpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RP737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-GeneID: 883957
NCBI-ProteinID: NP_221089
UniProt: Q9ZCJ5
Position
complement(924181..925359)
Genome map
AA seq 392 aa AA seqDB search
MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITG
GSGQNPARQTLIYADIPQEVPGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMS
LGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDAFAL
SSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRHNTSIEILSKLRPAFDKNGV
VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLIT
LIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtcttagtacaattccagcaccaatgttagctgcttatttaatcaaggatatactgcaa
aatagtaaaatcgagcctgctttagtaaatgaggtaatacttggacaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgccgatataccgcaagaagtt
ccaggttatactattaataaagtatgtggctcaggtcttaaaagtatagcacttgcagca
aattcaattattacatgcgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggatctaaattcggcgatatcaaaatggtt
gatctcatgcaatatgatggtttaatagatgtattttcaggagtatttatgggtattact
gccgaaaatatcgcgaagcagtttaatattagtcggcaagagcaggacgcattcgcctta
agttctcacaagaaagctgctaaagcacaattatcaggaattctacaagatgaaatcttg
cctatagaggtaacagtaaaaaaaaatactagtttgtttgatcatgatgaaacagtaaga
cataatacaagcattgaaattcttagtaaattacgccctgcttttgataaaaatggtgta
gttacagctggtaactcttcctctattaatgacggtgcagcatgtgttctgcttgtttca
gaaaaagctttgaagaaacataatttaacaccgttagcgcgtattgtttcttgggcttca
gctggtgttgatccaagaattatgggtactgcacctgtacctgcatctaaaaaagcatta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgca
gcacaaagtatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggcgcaagtggtggacgtcttcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtattggtatttctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system