KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0257Help
Entry
Rpal_0257         CDS       T00722                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00860  Porphyrin and chlorophyll metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpal_0257
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rpal_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 CbiJ
Motif
Other DBs
NCBI-ProteinID: ACE98817
UniProt: B3Q868
Position
272704..273450
Genome map
AA seq 248 aa AA seqDB search
MALLVTRPQPDGDATAKALRAKGYDVLLAPMLRFEPVPFPDDPDAHYTGVIVTSANALRA
LDDQPVLARLLKLPLFAVGKHTARKAQDAGFSDVIVADGDAAKLRIKIGDSLRGTDKRAG
ALLYLAGADLSRDLAGELREDGFDVVMQTAYRMVPLPSLPEDVCDAFAANRIEAVLHYSR
RSARAFIDATRTSGIEISALAIPQCCLSEAVSEVVREAGANQVMVARKPDEKALLEALDR
ALGPAKVN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtggctttgctcgtcacccgcccgcaacccgacggcgacgcgaccgcgaaggcgttgcgc
gccaagggctatgacgtgttgctggcgccgatgctgcggttcgagccggtaccgttcccc
gacgatcccgacgcccactacaccggcgtgatcgtcaccagcgccaatgcgctgcgtgcg
ctggacgaccagccggtgctggcgcggctgctcaagctgccgctgtttgcggtcggcaag
cacaccgctcgcaaggcgcaggacgccggcttcagcgacgtgatcgtggcggacggcgac
gccgccaagctcaggatcaagatcggcgacagcctccgcggcacagacaagcgggctggc
gcgttgctgtatctggcgggcgccgatctgtcgcgagacctcgccggcgaattgcgcgaa
gatggcttcgacgtggtgatgcagaccgcctaccggatggtgccgttgccgagcctgccg
gaggacgtatgcgatgcctttgcggccaatcgcatcgaggcggtgctgcactactcgcgg
cggagcgcccgggcgttcatcgacgcgacgcggacctccggcatcgagatttcggcgctg
gcgattccgcaatgctgcctgtcggaggcggtctccgaggtagtgcgcgaggctggcgcc
aaccaggtgatggtggcgcgcaagccggacgaaaaagcgctgctcgaagcgctggatcgg
gccctcggcccggccaaagtgaattga

DBGET integrated database retrieval system