KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0725Help
Entry
Rpal_0725         CDS       T00722                                 

Definition
(GenBank) benzoyl-CoA reductase, subunit B
  KO
K04113  benzoyl-CoA reductase subunit B [EC:1.3.7.8]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00362  Benzoate degradation
rpt01100  Metabolic pathways
rpt01120  Microbial metabolism in diverse environments
rpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpal_0725
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.8  benzoyl-CoA reductase
     Rpal_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGD-D
Motif
Other DBs
NCBI-ProteinID: ACE99284
UniProt: B3QDH1
Position
760375..761685
Genome map
AA seq 436 aa AA seqDB search
MTVIVGPKTKPPEAIKDASMARQKQMVNAHYDRLASAKERGEKVAATFVPGNLNELLMCF
DMVNNLPEVNAIQNGLRRQSGGYVMEAEKLGHSEDVCTYVKSDIGMMAKGNIGPNGKPLP
DPDVLLLSYTGCFTFMKWFELLRRQYKCETIMFQTPYLADGRITKDMISYMVKQLRQDVI
PKLERISGVKFDVDRLREYLRKSAKAEDDHVWVLQSAKHKPSPIDAYFGGIYYIGPIFGA
FRGTDDAIEYYKFLRSEVEQRIAQGKGPVTPDGDMGQERYRLVVEGPPNYTNFRQFWKMF
YDEGAVVVASSYTKVGGTYDYGFRHDPDRPLESLAEYCLNVYTNRNLPMRVDMLENYINE
YQADGLLINSIKSCNSFSAGQLLMMREVEKRTGKPAAFIETDLVDPRYFSAANVKNRLES
YFQMIEQKRAGFRGAA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcatcgtcggacctaagaccaagccgccggaagccatcaaggatgcctcgatg
gcgcggcagaagcagatggtcaacgcccattacgatcgcctcgccagcgccaaggagcgc
ggcgagaaggtcgctgcgaccttcgtgccgggcaatctcaacgagctgttgatgtgcttc
gacatggtcaacaacctgccggaggtcaacgcgatccagaacgggttgcggcggcagagc
ggcggctacgtgatggaggcggaaaagctcggccattccgaggacgtctgcacctacgtc
aaatccgatatcggcatgatggccaagggcaatatcggtccgaacggcaagccgttgccc
gacccggacgtgttgctgttgtcctacaccggctgcttcaccttcatgaaatggttcgag
ctgctgcgccggcagtacaaatgcgagaccatcatgttccagacgccgtatctggccgat
ggccggatcaccaaggacatgatcagctacatggtcaagcagctccggcaggacgtcatc
ccgaagctggagcggatctcgggcgtcaagttcgacgtcgatcggctgcgtgaatactta
cgcaaatccgccaaggccgaggacgatcacgtctgggtgctgcaatcggccaagcacaaa
ccgtcgccgatcgatgcctatttcggcgggatctattacatcgggccgattttcggcgcc
ttccgtggcaccgacgatgcgatcgagtattacaaattcctgcgctccgaggtcgaacag
aggatcgcgcaaggcaaggggccggtgacgcccgatggcgacatggggcaggagcgctac
aggctggtggtcgaagggccgccgaactacaccaatttccgccagttctggaagatgttt
tacgacgaaggcgccgtcgtggtcgcctcgagctacaccaaggtcggcggcacctacgat
tacggcttccgccacgaccccgacaggccgctggagtcgctcgccgaatactgcctcaac
gtctacaccaaccgcaatctgccgatgcgggtggacatgctggagaactatatcaacgaa
taccaggcggacggccttctgatcaattcgatcaagagctgcaattcgttctccgccggc
cagctcctgatgatgcgcgaggtcgagaaacgcaccggcaagccggcggcgttcatcgaa
acagaccttgtcgacccgcgctatttctccgccgccaacgtcaagaaccggctggagagc
tatttccagatgatcgaacagaagcgcgcgggcttccgcggcgccgcctga

DBGET integrated database retrieval system