KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0887Help
Entry
Rpal_0887         CDS       T00722                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00071  Fatty acid degradation
rpt00280  Valine, leucine and isoleucine degradation
rpt00281  Geraniol degradation
rpt00310  Lysine degradation
rpt00362  Benzoate degradation
rpt00380  Tryptophan metabolism
rpt00410  beta-Alanine metabolism
rpt00640  Propanoate metabolism
rpt00650  Butanoate metabolism
rpt00903  Limonene and pinene degradation
rpt00930  Caprolactam degradation
rpt01040  Biosynthesis of unsaturated fatty acids
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
rpt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpal_0887
   00650 Butanoate metabolism
    Rpal_0887
  Lipid metabolism
   00071 Fatty acid degradation
    Rpal_0887
   01040 Biosynthesis of unsaturated fatty acids
    Rpal_0887
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpal_0887
   00310 Lysine degradation
    Rpal_0887
   00380 Tryptophan metabolism
    Rpal_0887
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpal_0887
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpal_0887
   00281 Geraniol degradation
    Rpal_0887
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpal_0887
   00930 Caprolactam degradation
    Rpal_0887
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rpal_0887
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpal_0887
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rpal_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 FAD_binding_3 UDPG_MGDP_dh_N DAO F420_oxidored NAD_binding_8 ApbA Pyr_redox_2 GIDA NAD_Gly3P_dh_N 2-Hacid_dh_C Sacchrp_dh_NADP Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACE99444
UniProt: B3QEG5
Position
946609..948825
Genome map
AA seq 738 aa AA seqDB search
MAFKNFKVETDADGIALVTWDLPGKSMNVLDAATIEELGAIAEATTKDTAVKGVVITSAK
DAFCAGADLSMLESMNQQFAQIRKDKGEEAAQKMLFDESRKLSQILRGIETCGKPWVAAI
NGLALGGGFEVTLACHYRVAADNPKTRLGLPEIKVGLFPGGGGTQRIPRIVDPQSAMTIL
LKGDQIKLDKAKALKLVDAVVPAADLIKTAKDWIKNGGKAVALWDEKGFKLPGGQVFSKQ
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLLVPIDVALRIESRYFAHVLQTKEAAA
MIRSLFLSMQELNKGARRPQGVPPTKVKKLAIIGAGFMGASVGYVSAKAGIEVVLIDRDQ
ESADKGKAHCQSVIDGLIKKGRAKEADRDALMSRITATPDFNAISDCDLVIEAVFEDRKV
KAETYAKAQPLLKEGAIFASNTSTLPINSLAEEFKDQSKFIGIHFFSPVEKMMLVEVILG
NNTSDVTLATALDYTRQIGKTPIVVNDSRGFFANRCVLRFTAEGLEMLMEGVPAPMIETA
AKMAGMPVGPLSLADEVALDLILKIMKATEADLGEQAVDQQQKKLMVELVEKQGRFGRKN
AKGFYVYPEKGKGQKSLWDGIAALQPKHLDPDTIDVEELKQRFLAVQAVEAARTVEDNVI
VDPREADVGSILGFGFAPFTGGTLSYIDFMGTKEFVALCHKLEGKYGSRFTPPKLLEDMA
KTGDTFYHRFAPKKQAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaagaacttcaaagtcgagaccgacgccgacggcatcgcactggtgacctgg
gacctgcccggcaagtcgatgaacgtgctggacgctgcaacgatcgaggaactcggtgcg
atcgcggaagccaccaccaaggacacggcggtcaagggcgtggtgatcacctcggccaag
gacgcgttttgcgccggcgccgatctgtcgatgctggaaagcatgaaccagcagttcgcc
cagatccggaaagacaagggtgaagaagccgcccagaagatgctgttcgacgagagccgc
aagctgtcgcagatcctgcgcggcatcgagacctgcggtaagccgtgggtcgcggcgatc
aatggactggcgcttggcggcggcttcgaagtcacgctggcctgccactatcgcgtcgca
gccgacaatccgaagacccggctcggcctgcccgagatcaaggtcggcctgttcccgggc
ggcggcggtacccagcggattccgcgcatcgtcgatccgcagagcgcgatgacgatcctg
ctcaagggcgatcagatcaagctcgacaaggccaaggcgctgaagctggtcgacgcggtg
gtgccggcggccgatctgatcaagactgccaaggactggatcaagaacggcggcaaggcg
gtggcgctgtgggacgagaagggcttcaagctgcccggcggccaggtgttctccaagcag
ggcatgatgatgttcccggccggcaacgccatctatcgccgcgagacctacgacaactat
ccggccgcgcgcgcgatcatgagctgcgtctatgagggcctgttggtgccgatcgacgtc
gcgctgcggatcgagtcgcgctacttcgcgcacgtgctgcagaccaaggaagcggcggcg
atgatccgcagcctgttcctgtcgatgcaggagctgaacaagggcgcgcgccgtccgcag
ggtgtgccgcccaccaaggtcaagaagctcgccatcatcggcgctggcttcatgggcgcc
agcgtcggctacgtctcggccaaggccggcatcgaggtggtgctgatcgatcgcgaccag
gagagcgccgacaagggcaaggcacattgccagtcggtcatcgacggtctcatcaagaaa
ggccgcgccaaggaagccgaccgcgacgcgctgatgtcgcgcatcactgcgacgccggac
ttcaatgcaatctcggattgcgacctcgtcatcgaagcggtgttcgaggatcggaaagtg
aaggccgagacctacgccaaggcccagccgctgctcaaggaaggcgcgatcttcgcgtcg
aacacctcgacgctgccgatcaattcgctggccgaggagttcaaggaccagtcgaagttc
atcggcatccacttcttctcgccggtcgagaagatgatgctggtcgaagtgatcctcggc
aacaacaccagcgacgtcacgctggcgaccgcgctcgactacacccgccagatcggcaag
accccgatcgtggtgaacgacagccgcggcttcttcgccaaccgctgcgtgctgcgcttc
accgccgagggccttgagatgctgatggaaggcgtcccggcgccgatgatcgagaccgcg
gccaagatggccggcatgccggtcggcccgctgtcgctggccgacgaagtggcgctcgat
ctgatcctgaagatcatgaaggcgaccgaagcggatctcggcgaacaggcggtcgatcag
cagcagaagaagctgatggtcgagctggtcgagaagcagggcaggttcggccgcaagaac
gccaagggcttctacgtctatccggagaagggcaaggggcagaagagcctgtgggacggc
atcgccgcgctgcagccgaagcacctcgatcccgatacgatcgatgtcgaagagctgaag
cagcgcttcctggctgtgcaggcggtggaagcggcccgcacggtcgaggacaacgtcatc
gtcgacccgcgcgaggccgatgttggctcgatcctcggcttcggcttcgcgccgttcacc
ggcggcacgttgagctacatcgacttcatgggcaccaaggagttcgtggcgctgtgccac
aagctcgagggcaaatacggctcgcgcttcactccgccgaagctgctcgaagacatggcc
aagaccggcgataccttctaccaccgcttcgccccgaagaagcaggcggcggcgtag

DBGET integrated database retrieval system