KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1708Help
Entry
Rpal_1708         CDS       T00722                                 

Definition
(GenBank) O-methyltransferase family 2
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00906  Carotenoid biosynthesis
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    Rpal_1708
Enzymes [BR:rpt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     Rpal_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_23 Methyltransf_12 Methyltransf_25 Methyltransf_11 MTS Methyltransf_31 MarR_2 Sigma70_r3
Motif
Other DBs
NCBI-ProteinID: ACF00236
UniProt: B3Q7A2
Position
1831584..1832705
Genome map
AA seq 373 aa AA seqDB search
MVSLSLRDRLLGWRDSILSNPRFQRFAAVFPLMRPVARRRAVAMFDLVAGFVYSQILLAC
VQLRLFDIVAERPATAEDLAVRLGLPVDSLRVLLDGAVALRLLQMRSGHRYGLGQLGAEL
RGNPGVLALVAHHAMLYRDLADPVALLRAPRGGGELAAYWAYVRGERPGELPADAIASYT
ALMAASQPMIAREVLHVYSFRDHRCLLDVGGGDGSFLSAVAAQAPQLRCMLFDLPAVAEK
AAARFEANGLKGRATAVGGSFTTDPLPQGADIVSLVRVIHDHDDDVVEALLRAVHKALPD
NGKLLIAEPIAGLPGTAAISDAYFAFYLYAMGSGKARSFPRLQAMLENAGFSQVTLHPVP
MPLVASVITASKR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtctcattgagcctgcgtgaccggctgctcggctggcgcgattcgatcttgtcgaat
ccgcgctttcagcgttttgcagcggtgtttccgttgatgcgtccggtcgcgcgccggcgt
gccgtggcgatgttcgaccttgtcgccggcttcgtctattcacagatcctgctggcctgc
gtgcagctccggctgttcgacattgtcgctgagcgcccggccaccgccgaagaccttgcg
gtgcggctggggctgcctgtggactcgttgcgcgtgttgctcgatggggcggttgcgctt
cggctgctccagatgcgcagcggccatcgctacggcctcggccagctcggcgccgaactg
cgcggcaatccgggggtgctggcgctcgtggcgcatcacgccatgctgtatcgggatctt
gccgatccggtggcgctgctgcgcgcgccgcgcggtgggggggaactcgccgcctattgg
gcgtatgtccggggcgagcggcccggcgagctgccggccgatgcgattgcctcctatacc
gcgctgatggcggcgtcccagccgatgatcgcccgcgaggtgctgcacgtctattcgttc
cgcgatcaccgctgcctgctcgacgtcggcggcggcgacggctcattcctgtcggcggtc
gccgcgcaggcgccgcagctgcgctgcatgctgttcgacctgccggcggtagccgagaag
gcggccgcccggttcgaggcgaacggcctgaagggcagggcgaccgcggtcgggggcagt
ttcaccaccgacccgctgccccaaggcgccgacatcgtttcgctggtccgggtgatccac
gaccacgacgacgatgtcgtcgaagcgctgctgcgcgccgtccacaaggctttgcccgac
aacgggaaattgctgatcgccgagccgatcgccgggcttcccgggacggctgcgatctcc
gacgcctatttcgccttttacctttacgccatgggctccgggaaagcccggagcttccct
cgactgcaggcgatgttggagaatgcgggcttctcccaggtcactttgcacccggttccc
atgccgctggttgcttccgtaattaccgcatccaaacggtag

DBGET integrated database retrieval system