KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1724Help
Entry
Rpal_1724         CDS       T00722                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpal_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACF00252
UniProt: A5YN36
Structure
PDB: 

Position
complement(1846612..1847031)
Genome map
AA seq 139 aa AA seqDB search
MVKKLLTILSIAATAGSLSIGTASAQDAKAGEAVFKQCMTCHRADKNMVGPALGGVVGRK
AGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKKFLTDKGKADQAVGVTKMTF
KLANEQQRKDVVAYLATLK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaaaaacttctcacaattctcagcatcgccgctaccgccggatctctgtcgatc
ggcactgcctcggcccaggacgccaaggcgggtgaggcggtgttcaaacagtgcatgacc
tgccaccgcgccgacaagaacatggtcggtccggctctgggcggcgtcgtcggtcgtaag
gccggtaccgcggctggcttcacctattcgccgctgaaccacaattcgggtgaagcgggt
ctggtctggaccgccgacaacatcatcaactacctgaacgatccgaacgcgttcctgaag
aagttcctcaccgataagggtaaggctgatcaggcggtcggcgtcaccaagatgaccttc
aagctcgccaacgagcagcagcgtaaggacgtggtcgcctatctggccaccctcaagtaa

DBGET integrated database retrieval system