KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2700Help
Entry
Rpal_2700         CDS       T00722                                 

Definition
(GenBank) ThiJ/PfpI domain protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Rpal_2700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rpt01002]
    Rpal_2700
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     Rpal_2700
Peptidases [BR:rpt01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   Rpal_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ACF01209
UniProt: B3QH20
Position
complement(2931756..2932445)
Genome map
AA seq 229 aa AA seqDB search
MTTTTIGLLLFPNMTQLDLTGPLQVFSRLPNAKVYLVAKTMAPVTSDTALMLPPTIDFAH
CPQLDVICVPGGAGADDLVNDEDTLAFLRQQADQARYLTSVCTGALVLGAAGLLRGYRAT
THWSALEDLASFGAIPERSRVCIDRNRVSGGGVTAGIDFALTLAELLADRPTAQAIQLML
EYNPAPPFNAGSPDTAPQEVVAMLKQRMQGARQHRIDAVKRAADRLLRG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgaccatcggactgctgctgtttccgaacatgacgcagctcgacctcacc
gggccgctgcaggtgttctcaaggctgccgaacgcgaaagtgtatctggtggccaagacg
atggccccggtcaccagcgacaccgcgctgatgctgccgccgaccatcgacttcgcccac
tgcccgcagctcgacgtgatctgcgtgcccggcggcgccggcgccgacgatctggtcaat
gacgaggacaccctcgccttcctgcggcagcaggcggaccaggcacgctatctcacctcc
gtctgcaccggcgcgctggtgctcggtgcggcgggcctgctgcgcggctaccgcgcgacg
acgcattggtcggcgctggaggatctggcatccttcggggcgattccggagcggtcgcgg
gtctgcatcgaccgcaatcgtgtcagcggcggcggcgtgaccgccggaatcgattttgcg
ctgacgctggcggagctgctggccgaccgcccgaccgcgcaggcgatccagttgatgctg
gagtacaatccggcgccgccgttcaacgccggttctccggacaccgcgccgcaggaagtg
gtggcgatgctgaagcagcggatgcagggggcgcgtcagcaccgcatcgacgccgtcaag
cgtgcggccgatcggctgctacgcggttaa

DBGET integrated database retrieval system