KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3116Help
Entry
Rpal_3116         CDS       T00722                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00450  Selenocompound metabolism
rpt00970  Aminoacyl-tRNA biosynthesis
rpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rpal_3116
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rpal_3116
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpt01007]
    Rpal_3116
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpt03016]
    Rpal_3116
Enzymes [BR:rpt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Rpal_3116
Amino acid related enzymes [BR:rpt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Rpal_3116
Transfer RNA biogenesis [BR:rpt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Rpal_3116
 Prokaryotic type
   Other AARSs
    Rpal_3116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ACF01622
UniProt: B3QKH3
Position
3359595..3361139
Genome map
AA seq 514 aa AA seqDB search
MAQRNSFYITTAIAYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGLKMIQ
TAQKEGLTPHALATRNAGRFREMDDRLGVSYDRFIRTSEEQHHRSVQEVWKRMQDKGDIY
LDSYSGWYSVRDEAYYAEDETVVGEDKVRRGPQGTPVEWVEEKSYFFKLSAYQDKLLKLY
EDQPDFIGPDSRRNEVISFVKSGLKDLSVSRTTFDWGVKVPGDPEHVMYVWVDALTNYIS
GVGFPDENDANWHYWPADVHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNKGE
KMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGSDGSYNHEAIVNRINADLANDLGNL
AQRSLTMVAKQCEGKVPEHGAFSENDSAILAMADGMIAQARTAMATQQIHQALNAVWAVV
AEANRYFAGEAPWALAKTDPARQKTVLYVTAEVLRQIAILAQPAIPTAAAKLLDILGIAE
GQRDFAALATRIVPGTPLPAPAPIFPRYVEPATA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcgaaattcattctacatcaccaccgcgatcgcgtatcccaacggcgcgccg
catatcggccacgcctatgaggcgattgcgaccgacgcgctggcgcggttccagcggctc
gacggcaaggacgtgttcttcctgaccggcaccgacgagcacggcctgaagatgattcag
accgcgcagaaggaagggctgacgccgcacgcgctcgccacccgcaatgccggtcgcttc
cgcgagatggacgaccggctcggcgtctcctacgaccgcttcatccgcacctccgaggag
cagcatcaccgctcggtccaggaagtctggaagcggatgcaggacaagggcgacatctac
ctcgacagctattccggctggtactcggtccgcgacgaagcctactacgctgaagacgaa
actgtcgtcggcgaagacaaggtacgccgcggcccgcagggtacgccggtcgaatgggtc
gaagagaagagctacttcttcaagctgtccgcctatcaggacaagctgctcaagctgtac
gaggaccagcccgacttcatcggcccggactcgcgccgcaacgaggtgatcagcttcgtc
aagagcggactgaaggatctgtcggtgtcgcgcaccaccttcgactggggcgtcaaggtg
ccgggcgatccggagcacgtgatgtatgtctgggtcgacgcgctgaccaactacatcagc
ggcgtcggcttccccgacgagaacgacgccaactggcactactggccggcggacgtgcat
gtcatcggcaaggacatcatccgcttccacgcggtgtactggccggcgttcctgatgtcg
gcgggcatcccggtgcagaagcgcgtttacgcccacggcttcctgttcaacaagggcgag
aagatgtcgaagtcggtcggcaacatcgtcgaccccttcaatcttgccgaccagtacggc
gtcgatcaggtgcgctacttcttcctgcgcgaggtgccgttcggctccgacggcagctac
aatcacgaggcgatcgtcaaccgcatcaacgccgacctcgccaatgacctcggcaacctg
gcgcagcgctcgctgaccatggtggccaagcagtgcgaaggcaaagtgccggagcatggc
gcgttcagcgagaacgatagcgcgatcctggcgatggccgacggcatgatcgcgcaggcg
cggaccgcgatggcgacgcagcagatccatcaggcgctgaacgcggtgtgggcggtggtg
gcggaagccaaccgttacttcgccggcgaagcaccgtgggcgctcgccaagaccgatccg
gcgcgacagaagacggtgctctacgtcaccgccgaagttctgcggcagatcgcgatcctg
gcccagccagcgatcccgaccgcggcggccaagctgctcgacatcctcggcatcgccgag
gggcagcgcgacttcgcggcgctagcgacccggatcgtgccgggtacaccgctgcctgcg
ccggccccgatcttcccgcgctacgtcgaaccggcgaccgcgtaa

DBGET integrated database retrieval system