KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3872Help
Entry
Rpal_3872         CDS       T00722                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00790  Folate biosynthesis
rpt01100  Metabolic pathways
Module
rpt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpal_3872
Enzymes [BR:rpt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rpal_3872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACF02370
UniProt: B3QE25
Position
complement(4159653..4160342)
Genome map
AA seq 229 aa AA seqDB search
MDAKIKPIRGTNPAEGRPEFQPAELEPSEFLEVAVQPDQPRPSRAEAEAAVKTLLSYIGE
NTEREGLIDTPRRVVEAYDELFQGYHQCPKEVLERTFGETAGYDDFVLVRNISFTSHCEH
HVMPFYGKAHIAYTPVERVVGLSKLARLVDIFARRLQTQEHLTAQIAAAIDEVLKPRGVA
VLLEAEHTCMSVRGIAKKGATTFTSRYTGVFRDNPAEQARFMSMVRDRG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggacgccaaaatcaagccgatccgcggcaccaatccggccgaaggccgccccgaattc
cagcccgccgagctcgaaccgtccgagttcctcgaagtcgcggtgcagcccgatcagcca
cgcccgtcccgcgccgaggctgaggccgcggtgaagacgctgctgtcctatatcggcgag
aacaccgagcgcgaggggctgatcgataccccgcgccgggtggtcgaggcctatgacgag
ctgttccagggttatcaccagtgcccgaaggaagtgttggagcgcaccttcggcgaaacc
gccggctatgacgatttcgtcctggtccgcaacatcagcttcacctcgcattgcgagcac
cacgtgatgccgttctacggcaaggcgcacatcgcctatacgccggtggagcgcgtggtc
gggctgtcgaagctggcgcgcctcgtcgacatcttcgcccgccggctgcaaactcaggag
catctcaccgcgcagatcgccgccgcgatcgacgaggtgctgaaaccgcgcggcgtcgcg
gtgctgctcgaagccgagcacacctgcatgtcggtgcgcggcatcgccaagaagggcgcc
accaccttcaccagccgttacaccggcgtgttccgcgacaatccggcggagcaggcacgg
ttcatgtcgatggtcagggaccgcggctaa

DBGET integrated database retrieval system