KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4176Help
Entry
Rpal_4176         CDS       T00722                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00010  Glycolysis / Gluconeogenesis
rpt00071  Fatty acid degradation
rpt00350  Tyrosine metabolism
rpt00625  Chloroalkane and chloroalkene degradation
rpt00626  Naphthalene degradation
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_4176
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rpal_4176
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Rpal_4176
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rpal_4176
   00626 Naphthalene degradation
    Rpal_4176
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rpal_4176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 PglD_N ThiF TrkA_N
Motif
Other DBs
NCBI-ProteinID: ACF02672
UniProt: B3QGJ5
Position
complement(4479937..4480989)
Genome map
AA seq 350 aa AA seqDB search
MRSFRVTDFGKPLSEDNRPTPELTGTQVLVRVKAAGICHSDLHIWEGGYELGHGRKKLSL
ADRGVALPLTMGHETVGEIVAAGPNAKDAKIGQVALVYPWIGCGECDVCKAGDENMCLKP
RFLGVYCDGGYSDELIVPHPRYLLSLDGLDPVTAAPYACSGITTYSALKKLDFCLDSPIV
IFGAGGLGLMALELLKAMGGKGAIMVDIDAAKRDAAQKAGALGTVDGAAPDALAQIAAIA
KGPVRGALDLVGNPQTAQLGFDCLTKGGKLVIVGLFGGGAPWALPFIPMRAITIQGSYVG
NLAETQELLDLVRAKKVSPIPVTKVALPQAYDALIDLQKGKLVGRAVLTP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaggagctttcgcgtcactgatttcggcaagccgctgagcgaagacaaccggccgacg
ccggaactgaccggcacgcaagtgctggtccgcgtcaaggccgccggcatctgccatagc
gatctgcacatctgggaaggcggttacgaactcggccacggccgcaagaagttgtcgctc
gccgatcgcggcgtcgcattgccgctgacgatgggccacgagaccgtcggcgagatcgtc
gccgctggtcccaacgccaaggatgccaagatcgggcaggtcgcgctggtgtatccgtgg
atcggctgcggcgaatgcgacgtctgcaaggccggcgacgagaatatgtgcctgaagccg
cggtttctcggcgtgtattgcgacggcggctactcggacgaactgatcgtgccgcatccg
cgctatctgctcagccttgatgggctcgatccggtgaccgcagcgccctatgcgtgctcc
ggcatcaccacctacagcgcgctgaagaagctcgacttctgcctcgacagcccgatcgtg
atcttcggtgccggcggactcggattgatggcgctggagctgctcaaggcgatgggcggc
aagggcgccatcatggtcgatatcgacgcggccaagcgcgatgcggcccaaaaggccggc
gcgcttggcacggtcgatggcgccgcgccggacgcgctggcgcagatcgcggccatcgcc
aaaggtccggtgcgcggtgcgctggatctggtcggcaatccgcagaccgcgcagctcggc
ttcgattgcctcaccaagggcggcaagctggtgatcgtcggtctgttcggcggcggcgca
ccatgggcgctgccgttcatcccgatgcgtgccatcaccatccagggcagctatgtgggt
aatctcgccgaaacccaggaactgctcgaccttgtccgcgccaagaaggtgtcgccgatc
ccggtcactaaggtggcgctgccgcaggcttacgatgcgctcattgatctgcagaagggc
aagctggtcggtcgcgcggtgctgacgccgtag

DBGET integrated database retrieval system