KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4215Help
Entry
Rpal_4215         CDS       T00722                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpal_4215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Haem_bd
Motif
Other DBs
NCBI-ProteinID: ACF02711
UniProt: B3QGN4
Position
complement(4521109..4521663)
Genome map
AA seq 184 aa AA seqDB search
MDTFELNKIVGAIFGTLLILLLSNFTAQAIFSPTKPEKQGYAIVVKEAEPAQAKDAAPKA
DEPIEKLLQTASVDQGSKVAKKCAACHTFEKDGPNRVGPNLYGIVGDHRGEGRNGFNFSA
AMKAKGGAWTFDELNKFLANPKGYIPGTAMSFAGVPNDKERADLIAYLNKNSDKPEALPA
TAEK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatactttcgaactcaacaaaattgtcggcgcgatcttcgggaccttgctgatcctg
ctgctgtccaatttcaccgcccaggcgatcttctctccgaccaagcctgaaaaacagggc
tatgccatcgtagtgaaggaagccgagccggcgcaggcgaaggatgctgcgccgaaggcg
gacgagccgatcgagaagctgctgcagaccgcctcggtcgatcagggctccaaggtcgcc
aagaagtgcgcggcctgccacaccttcgagaaggacggcccaaaccgcgtcggcccgaac
ctctacggcatcgtcggcgaccatcgcggcgaaggccgaaacggtttcaatttctcggct
gcgatgaaggccaagggcggcgcctggacgttcgacgagctcaacaagttccttgcgaac
ccgaagggctacattccgggcaccgcgatgagcttcgccggcgtcccgaacgacaaggaa
cgggccgacctgatcgcctatctcaacaagaattccgacaagcccgaggcgctgccggcg
acggccgagaagtaa

DBGET integrated database retrieval system