KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4236Help
Entry
Rpal_4236         CDS       T00722                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00071  Fatty acid degradation
rpt00072  Synthesis and degradation of ketone bodies
rpt00280  Valine, leucine and isoleucine degradation
rpt00310  Lysine degradation
rpt00362  Benzoate degradation
rpt00380  Tryptophan metabolism
rpt00620  Pyruvate metabolism
rpt00630  Glyoxylate and dicarboxylate metabolism
rpt00640  Propanoate metabolism
rpt00650  Butanoate metabolism
rpt00900  Terpenoid backbone biosynthesis
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
rpt01212  Fatty acid metabolism
rpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpal_4236
   00630 Glyoxylate and dicarboxylate metabolism
    Rpal_4236
   00640 Propanoate metabolism
    Rpal_4236
   00650 Butanoate metabolism
    Rpal_4236
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rpal_4236
   00072 Synthesis and degradation of ketone bodies
    Rpal_4236
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpal_4236
   00310 Lysine degradation
    Rpal_4236
   00380 Tryptophan metabolism
    Rpal_4236
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rpal_4236
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpal_4236
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rpal_4236
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpt04147]
    Rpal_4236
Enzymes [BR:rpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rpal_4236
Exosome [BR:rpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpal_4236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACF02732
UniProt: B3QH98
Position
complement(4547984..4549171)
Genome map
AA seq 395 aa AA seqDB search
MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQ
GATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESI
SLVQNDKMNTFHAVDPALEAIKGDVYMAMLDTAETVAKRYGISRERQDEYSLESQRRTAA
AQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGLKAVRGEG
FTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEMGIGPVFAVPR
LLKRHGLTVDDIGVWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGHPYGMSGARLT
GHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEIVH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggccgttatcgtttcaaccgcgcgcacgccgatcggcaaggcgtatcgcggc
gccctcaacgccaccgagggcgccacgctgctcggccacgccatcgagcacgcggtgaag
cgcgccggaatcgacccgaaggaggtcgaggacgtggtgatgggcgcggcgatgcagcag
ggcgccaccggcggcaacatcgcccgcaaggcgctgctgcgcgccggcctgccggtgacc
accgccggcaccaccatcgaccggcagtgcgcgtccggcctgcaggcgatcgcgctcgct
gcccgctcggtgctgttcgacggcgtcgagatcgcggtcggcggcggcggcgagtcgatc
tcgctggtgcagaacgacaagatgaacaccttccacgccgtcgatccggcgctcgaggcg
atcaagggtgacgtctacatggcgatgctcgacaccgccgaaaccgtggcgaagcgctac
ggcatctcgcgcgagcgccaggacgagtattcgctggaaagccagcgccgcaccgcagcg
gcgcagcagggcggcaagttcaacgacgagatcgcgccgatctccaccaagatgggcgtc
gtcgacaaggccaccggcgcagtgtcgttcaaggacatcacgctgtcgcaggacgaaggc
ccgcggccggagacgaccgccgaaggtctcgccggtcttaaggccgtgcgtggtgaaggc
ttcaccatcactgccggcaatgccagccagctgtcggacggcgcgtcggccacggtgatc
atgagcgacaagacggcggccgcgaagggcctcaagccgctcggcatcttccgcggcatg
gtctcctacggctgcgagccggacgagatgggcatcggcccggtgttcgcggtgccgcgc
ctgctcaagcgccacggcctgaccgtcgacgacatcggcgtttgggagctgaacgaggca
ttcgccgtgcaggtgctgtactgccgcgataagctcggcatcgatccggagaagctcaac
gtcaacggcggcgcgatctcggtcggccacccctacggcatgtcgggcgcccgcctgacc
ggccacgcgctgattgaaggccgccgccgcaaggcgaagtacgcggtggtcacgatgtgc
gttggcggcggcatgggctccgccggcctgttcgagatcgtgcactga

DBGET integrated database retrieval system