KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4444Help
Entry
Rpal_4444         CDS       T00722                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00010  Glycolysis / Gluconeogenesis
rpt00071  Fatty acid degradation
rpt00350  Tyrosine metabolism
rpt00625  Chloroalkane and chloroalkene degradation
rpt00626  Naphthalene degradation
rpt00680  Methane metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
rpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpal_4444
  09102 Energy metabolism
   00680 Methane metabolism
    Rpal_4444
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rpal_4444
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Rpal_4444
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rpal_4444
   00626 Naphthalene degradation
    Rpal_4444
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rpal_4444
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     Rpal_4444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C ThiC_Rad_SAM UDPG_MGDP_dh_N PEP-CTERM
Motif
Other DBs
NCBI-ProteinID: ACF02940
UniProt: B3QIY4
Position
complement(4773282..4774337)
Genome map
AA seq 351 aa AA seqDB search
MSVTFRAAVLHELNQPLSIETVEAPPLAAGQVLVKLAYSGVCHSQVMEARGGRGPDRYLP
HMLGHEGSGVVVEIGGGVTKVKRGDHVILGWIKGQGADTQGVRYASGERVINAGAVTTFN
EYAVVAENRVTPLPAGLPMDVAVLFGCALPVGAGIVINIAKPQPGATLAIFGLGGIGLAA
LMACKLFACKQVIAVDVEAAKLKMATELGATTVIDASRSDPVEEIRKLTGGLGVDYAIES
AGLTRVIEQAFDATRRFGGLCVFASHPRSGEKIALDPFELICGKRILGTWGGDSKPERDI
ELLAGLYRDGKLPLDAMFTRRYKLDEINKALDDLEHRRSVRPLIEIDPSLR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaccttccgcgctgcggtgctgcatgaactcaatcagccgctctcgatcgag
acggtcgaagcgccgccgctcgcggcggggcaggtgctggtcaagctcgcctattccggc
gtctgccatagtcaggtgatggaagcgcggggcgggcgcgggccggatcgctatctgccg
cacatgctcgggcatgaaggctccggcgtcgtcgtcgagatcggtggcggggtcaccaag
gtcaagcgcggcgatcatgtcattctcggctggatcaaggggcagggcgccgacacccag
ggggtgcgctacgccagcggggagcgtgttatcaacgccggcgcggtgaccacgttcaac
gaatatgccgtcgtcgcggagaaccgggtcacgccgctgccggccggactgccgatggat
gttgcggtgctgttcggctgcgcgctgccggtcggcgccggtatcgtcatcaacatcgcc
aaaccgcagccgggcgcgacgctggcgatcttcggcctcggcggcatcgggctcgcggcg
ctgatggcctgcaagctgtttgcctgtaagcaggtgattgctgtcgatgtcgaagccgcc
aagctgaaaatggcgaccgagctcggcgccacgacggtgatcgacgcctcgcgcagtgat
ccggtcgaggagatccgaaagctcaccggcggcctcggcgtcgactacgcaatcgaatcc
gccggcctcacccgcgtgatcgagcaggcgttcgacgccacgcggcggttcggcgggcta
tgcgtgttcgcctcgcatccgcggagcggcgaaaagatcgcactcgatccgttcgaactg
atctgcggcaagcgaatcctcggcacctggggaggcgacagcaagccggaacgcgacatc
gagttgctggcggggctgtaccgcgatggcaagctgccgctcgatgcgatgttcacccgc
cgctacaagctcgacgagatcaacaaggcgctggacgatctggagcatcgccgcagcgtt
cgcccgctgatcgaaatcgatccgtcgctgaggtga

DBGET integrated database retrieval system