KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4473Help
Entry
Rpal_4473         CDS       T00722                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K15856  GDP-4-dehydro-6-deoxy-D-mannose reductase [EC:1.1.1.281]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00051  Fructose and mannose metabolism
rpt00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rpal_4473
   00520 Amino sugar and nucleotide sugar metabolism
    Rpal_4473
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.281  GDP-4-dehydro-6-deoxy-D-mannose reductase
     Rpal_4473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ACF02969
UniProt: B3QJ13
Position
4810611..4811594
Genome map
AA seq 327 aa AA seqDB search
MAASARPLRILITGATGFVGLHSAAAIRRTFGAGTEIIPTALYAGKDPALGEVMALDVTD
PSAVATMIAKLQPSHVVNLAALAAPSAANADPSASWRVHLDGPRNIGRAILQAAPACVLL
HVGSGLAYGKNRPPICPTSEDRVLAPIDEYGASKAAADVALGPLIAKGLHCIRLRPFNHT
GPGQTDAFVVPAFARQIARIEAGLAPPQMQVGNLDGQRDFLDVRDVVAAYAETIARSDSL
APDTILNIASGVPRRIGDMLQQLLTMARVPIAVRNDPARGKSDAADVILGDASRARSMLN
WKPTIAFEQTLADVLEDQRSEVAKIAK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcggcgcggccgttacggattctcatcactggagcgaccggcttcgtcggt
ctgcattcggccgctgcaatccgtcgaacgtttggcgctggcaccgaaatcattccaacc
gcactttatgccggcaaagatccggctctcggcgaggtaatggctctcgatgtcaccgat
ccgagcgctgtcgccacgatgattgccaagcttcaaccgagccacgtcgtcaatctcgcg
gcgcttgccgcgccctctgcggccaatgcggacccgtcggcgagctggcgtgtgcatctc
gacggtccgcgcaacatcgggcgcgcaatcctgcaagcagctccggcctgtgtactgctg
catgtcggttcgggcctcgcctacggaaagaaccgtccaccgatctgtccgaccagcgag
gacagggtgctcgcgcccatcgacgagtatggtgcttcaaaggccgcagctgacgtggcg
ctcggcccgctgatcgccaagggactgcactgcatccggttgcggccgttcaatcacacc
ggcccgggccagactgacgcgttcgtcgttccagcattcgcccgccagatcgcgcggatc
gaggccggccttgcgccgccgcagatgcaggttggcaacctcgatggtcagcgtgacttt
ctcgacgtgcgtgacgtggtcgccgcctatgcggaaacgatcgcccgcagcgacagcctc
gcgcccgacacgattctcaacatcgcctcaggcgtgccgcgccggatcggcgacatgctg
cagcaattgctgacaatggcacgtgtcccgatcgccgtgcggaacgatccggcacgaggt
aagagtgacgccgccgatgtcatcctcggcgatgcaagccgagcacgatcgatgcttaac
tggaagccgaccatcgcattcgagcaaacccttgctgacgtgctcgaggaccaaagatcc
gaggtcgcaaagatcgcaaagtaa

DBGET integrated database retrieval system