KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4697Help
Entry
Rpal_4697         CDS       T00722                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00620  Pyruvate metabolism
rpt00630  Glyoxylate and dicarboxylate metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01200  Carbon metabolism
Module
rpt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpal_4697
   00630 Glyoxylate and dicarboxylate metabolism
    Rpal_4697
Enzymes [BR:rpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rpal_4697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACF03188
UniProt: B3QKU1
Position
5055908..5058082
Genome map
AA seq 724 aa AA seqDB search
MNRIDAHGLKIAPVLFDFIAKEAAPKTGIAPDVFWAGLAAIVRDLAPKTRALLKTRDDLQ
AKIDAWHLANKGKKQDMAAYTAFLKEIGYLLPEPPTVPVETANIDEEIGKLCGPQLVVPL
SNARYALNAANARWGSLYDAFYGTDAIPQEATQAKGYDKARGDKVIAKAKAFLDQAAPLA
TGSHSDVTGYSVIAGQLSAKLKSGNATGLKKPAQFAGFRGDAANPSAVLLVNNGLHIEIK
IDRANTIGKDDPAGVADLVIESAVSTILDMEDSVAAVDADDKVLIYRNTLGLMDGTLSES
FEKGGKTVTRALNGDRTYTAPDGKEISLHGRSLLLMRNVGHHMWTDAVLDSDGQEIPEGF
LDAAVSGLIAIHDLKHLGKTRNSRTGSVYIVKPKMHGPDEVALTVELFGRVETMLGLTAN
TLKVGIMDEERRTTVNLKACIQNASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMKA
QPWIKAYEDWNVDTGLVDGLPGHAQIGKGMWAAPDKMADMLAQKIGHPQAGATTAWVPSP
TAATLHALHYHQVDVIARQQELAKGGPRAKLEDILTIPVSNSNWAPDDVRQEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTKDQVLDSLKRM
AVIVDKQNEGDALYRPIAPDFDGVAFEAACDLIFKGRAQPNGYTEYILHERRREAKAAHL
ESAR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtattgacgcccacggactgaaaatcgcgcctgtgctgttcgacttcatcgcc
aaggaggccgcgccgaaaaccggcatcgctcccgacgtattctgggccgggctcgctgcg
atcgttcgtgatctggcgccgaagacccgcgcgctgctgaagacccgcgacgacctgcag
gccaagatcgatgcgtggcatctcgccaacaagggcaagaagcaggacatggcggcctac
accgccttcctgaaggagatcggctacctgctgcccgagccgccgacggtgccggtcgag
accgccaatatcgacgaagagatcggcaagctgtgcggcccgcagctcgtggtgccgctg
tcgaatgcgcgctacgcactgaatgccgccaacgcgcgctggggttcgctgtacgacgca
ttctacggcaccgacgcgatcccgcaggaagccacccaggctaagggctacgacaaggcg
cgcggcgacaaggtgatcgccaaggccaaggcattcctcgaccaagccgcgccgctcgcg
accggcagccatagcgacgtcactggttacagcgtgatcgccggccagctgtcggccaag
ctgaagagcggcaatgccaccggcctgaagaaaccggcacagttcgccggcttccgcggc
gatgccgccaatccgagcgcggtgctgctggtcaacaacggcctgcacatcgagatcaag
atcgatcgcgccaacaccatcggcaaggacgatccggccggcgtcgccgacctggtcatc
gagtcggcggtctcgaccattctcgacatggaagactcggtcgccgccgtcgatgccgac
gacaaggtgctgatctatcgcaacaccctcggcctgatggacggcacgctgtcggaaagc
tttgagaagggcggcaagaccgttacccgcgcgctcaacggcgaccgcacctacaccgcg
ccggacggcaaggagatctcgctgcacggccgcagcctgctgctgatgcgcaacgtcggc
catcacatgtggaccgatgcggtgctcgacagcgacggccaggagattccggaaggcttc
ctcgacgctgcggtgtccggcctgatcgcgatccacgatctcaagcacctcggcaagacc
cgcaacagccgcaccggctcggtctacatcgtcaagccgaagatgcacggcccggatgaa
gtcgccctcaccgtcgagctgttcggccgcgtcgagaccatgctcggcctgaccgcgaac
accctgaaggtcggcatcatggacgaggaacgccgcaccacggtgaacctcaaggcctgc
atccagaacgcgtcgaagcggatcgtcttcatcaacaccggcttcctcgatcgcaccggc
gacgagatccacacctcgatggaagcgggtccgatgatccgcaagaacgagatgaaggcg
cagccctggatcaaggcctacgaagactggaacgtcgacaccggtttggtcgacggcctg
ccgggtcacgcccagatcggcaagggcatgtgggcggcccccgacaagatggccgacatg
ctggcgcagaagatcggtcacccgcaggccggcgcgaccaccgcctgggtgccgtcgccg
accgccgcgacgctgcacgcgctgcactatcaccaggtcgacgtgatcgcgcgccagcag
gagctggcgaagggcggtccgcgcgccaagctcgaagacatcctcaccatcccggtgtcg
aactcgaactgggcgccggacgatgtccgccaggagatcgacaacaactgccagggcatc
ctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaaggtgccggacatc
cacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcaagccagcacctcgcc
aactggctgcatcacggcgtcgtcaccaaggaccaggtgctcgactcgctgaagcggatg
gcggtgatcgtcgacaagcagaacgaaggcgatgcgctgtaccggccgattgcgccggac
ttcgacggcgtcgcgttcgaagccgcgtgcgacctgatcttcaagggccgcgcgcagccg
aacggctacaccgaatacatcctgcatgagcgccgccgcgaggccaaggcggcgcacctg
gagtcggcacgctaa

DBGET integrated database retrieval system