KEGG   Rhodopseudomonas palustris TIE-1: Rpal_5255Help
Entry
Rpal_5255         CDS       T00722                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
rpt  Rhodopseudomonas palustris TIE-1
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Rpal_5255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACF03742
UniProt: B3QCE1
Position
5667787..5668179
Genome map
AA seq 130 aa AA seqDB search
MYRAVTRRIEVTVEPNYLPERSSAENRQYFWSYTVVITNSGEETVKLRTRHWVITDASGR
TQEVRGEGVVGEQPVLAPGERFEYTSGVPLPTASGFMAGRYQMETEAGEKFEIDVPPFSL
DSPEGKRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgccgtcacccgccggatcgaagtgaccgttgagcccaattatctgcccgag
cgttcctcggcggagaaccgccagtatttctggtcctacaccgtggtgatcaccaattcg
ggcgaggaaaccgtcaagctgcgcacccggcattgggtgatcaccgacgcctccggccgg
acccaggaagtgcgcggcgaaggcgtggtcggcgaacaaccggttctcgcgccgggtgag
cggttcgaatataccagcggcgtccccctcccgaccgcctccggcttcatggccggccgc
tatcagatggaaaccgaagcgggcgaaaaattcgagatcgacgtcccgccgttctcgctc
gacagcccagaagggaagcggacgctgaattga

DBGET integrated database retrieval system