KEGG   Ralstonia pseudosolanacearum: CDC45_14670Help
Entry
CDC45_14670       CDS       T05645                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
rpu  Ralstonia pseudosolanacearum
Brite
KEGG Orthology (KO) [BR:rpu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CDC45_14670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AST28375
UniProt: A0A223GQS7
Position
complement(3106601..3106975)
Genome map
AA seq 124 aa AA seqDB search
MSRYELTVQVRTRYLPEQSEPSQDQYAFAYTITIRNTGEVPSQLVSRHWVITDAESHVQE
VAGLGVVGHQPLLPPGESFEYTSWATIKTPVGTMRGEYFCVAEDGHRFEAPIPEFALAMP
RMLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctacgaactcaccgtccaggtccggacgcgctacctgcctgagcaatccgag
ccctcgcaggaccagtacgcctttgcctacaccatcactatccgcaatacgggcgaggta
ccgagccagctggtctcgcggcactgggtcatcaccgacgcggagagccacgtgcaggag
gtcgccggcctcggcgtggtcggccaccagccgctgctgccgccgggcgaatcgttcgag
tacaccagctgggcgaccatcaagacgccggtgggcaccatgcgcggcgaatacttctgc
gtggccgaggacggccatcgcttcgaggcgccgattcccgagtttgcgctggcgatgccg
cgcatgctgcattga

DBGET integrated database retrieval system