KEGG   Ralstonia pseudosolanacearum: CDC45_19720Help
Entry
CDC45_19720       CDS       T05645                                 

Definition
(GenBank) 2,3-diaminopropionate biosynthesis protein SbnB
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
rpu  Ralstonia pseudosolanacearum
Pathway
rpu00998  Biosynthesis of secondary metabolites - other antibiotics
rpu00999  Biosynthesis of secondary metabolites - unclassified
rpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    CDC45_19720
   00999 Biosynthesis of secondary metabolites - unclassified
    CDC45_19720
Enzymes [BR:rpu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     CDC45_19720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH Sacchrp_dh_NADP THF_DHG_CYH_C GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AST29461
UniProt: A0A223GTS9
Position
unnamed:530307..531329
Genome map
AA seq 340 aa AA seqDB search
MTHPADTTGLLYLGRQDLVALGGDRSQPYVDAITEGLALHAKDDFVQPLKPYLRWPGADH
IADRIIAMPCYVGGEKPIAGLKWIGSRQHNPSRFQLERASAVIVLNDADTNYPVAIMEGG
LISGMRTAAISAVATRHLAREGFTDVACIGCGPIARMQMQTLIEQFPGIRRIHLFDVSRD
AMRAFGEALTARFPQVACEAADSAEQAVRAADVIVTCTVTDSPYLEYDWLRRGAFVCNVS
IMDVHKEVYEKADKVVVDDWDQSNREKKVINQLVLEGRFSRERLHAELGEIVIGERPGRE
NDDEIILLNPMGMAIDDMVCARHFYQLAARAGVGTRLPLL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacccatccagccgataccaccggtctgctttaccttggccgccaggacctggtcgcc
ctcggcggcgaccgctcgcagccttacgtcgacgcgatcaccgaagggctcgccctgcat
gcgaaggacgacttcgtgcagccgctcaagccgtacctgcgctggcccggcgccgaccac
atcgccgaccgcatcatcgcgatgccgtgctatgtcggcggcgagaagccgatcgcgggg
ctgaagtggatcggcagccgccagcacaatccgtcgcgcttccagctcgaacgcgcgagc
gccgtgatcgtgctcaacgacgccgacaccaactatcccgtcgccatcatggaaggcggc
ctgatcagcggcatgcgcacggccgcgatcagcgcggtcgcgacgcggcacctggcgcgc
gagggcttcaccgacgtcgcctgcatcggctgcggcccgatcgcgcggatgcagatgcag
acgctgatcgagcagttccccggcatccgccgcatccatctcttcgatgtgtcccgggac
gcgatgcgcgcgttcggcgaggcgctcacggcgcgtttcccgcaagtggcgtgcgaagcg
gccgacagcgcggagcaggccgtgcgcgcggccgacgtgatcgtcacctgcaccgtcacc
gattcgccctatctcgaatacgactggctgcggcgcggggccttcgtctgcaacgtgtcg
atcatggacgtgcacaaggaggtctacgagaaggccgacaaggtggtcgtcgacgactgg
gatcagtcgaaccgcgaaaagaaggtcatcaaccagctggtgctcgaaggccgcttcagc
cgcgagcgcctgcatgccgaactgggcgagatcgtgatcggcgaacgccccgggcgcgag
aacgacgacgagatcatcctgctcaacccgatgggcatggcgatcgacgacatggtctgc
gcgcgccatttctatcagcttgccgcgcgggccggtgtcggcacgcggctgccgctgcta
tga

DBGET integrated database retrieval system