KEGG   Rickettsia prowazekii RpGvF24: MA7_03560Help
Entry
MA7_03560         CDS       T01793                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpv  Rickettsia prowazekii RpGvF24
Pathway
rpv00071  Fatty acid degradation
rpv00280  Valine, leucine and isoleucine degradation
rpv00310  Lysine degradation
rpv00362  Benzoate degradation
rpv00380  Tryptophan metabolism
rpv00620  Pyruvate metabolism
rpv00630  Glyoxylate and dicarboxylate metabolism
rpv00640  Propanoate metabolism
rpv00650  Butanoate metabolism
rpv00900  Terpenoid backbone biosynthesis
rpv01100  Metabolic pathways
rpv01110  Biosynthesis of secondary metabolites
rpv01120  Microbial metabolism in diverse environments
rpv01130  Biosynthesis of antibiotics
rpv01200  Carbon metabolism
rpv01212  Fatty acid metabolism
rpv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MA7_03560
   00630 Glyoxylate and dicarboxylate metabolism
    MA7_03560
   00640 Propanoate metabolism
    MA7_03560
   00650 Butanoate metabolism
    MA7_03560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MA7_03560
   00072 Synthesis and degradation of ketone bodies
    MA7_03560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MA7_03560
   00310 Lysine degradation
    MA7_03560
   00380 Tryptophan metabolism
    MA7_03560
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MA7_03560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MA7_03560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MA7_03560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpv04147]
    MA7_03560
Enzymes [BR:rpv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MA7_03560
Exosome [BR:rpv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MA7_03560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: AFE53723
Position
complement(924724..925902)
Genome map
AA seq 392 aa AA seqDB search
MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITG
GSGQNPARQALIYADIPQEVPGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMS
LGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDAFAL
SSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRPNTSIEILSKLRPAFDKNGV
VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLIT
LIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtcttagtacaattccagcaccaatgttagctgcttatttaatcaaggatatactgcaa
aatagtaaaatcgagcctgctttagtaaatgaggtaatacttggacaagtaataacaggt
ggtagtggacagaatccagcaagacaagctctgatttatgccgatataccgcaagaagtt
ccaggttatactattaataaagtatgtggctcaggtcttaaaagtatagcacttgcagca
aattcaattattacatgcgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
cttggtatgcacggtagttatatcagagcaggatctaaattcggcgatatcaaaatggtt
gatctcatgcaatatgatggtttaatagatgtattttcaggagtatttatgggtattact
gccgaaaatatcgcgaagcagtttaatattagtaggcaagagcaggacgcattcgcctta
agttctcacaagaaagctgctaaagcacaattatcaggaattctacaagatgaaatcttg
cctatagaggtaacagtaaaaaaaaatactagtttgtttgatcatgatgaaacagtaaga
cctaatacaagcattgaaattcttagtaaattacgccctgcttttgataaaaatggtgta
gttacagctggtaactcttcctctattaatgacggtgcagcatgtgttctgcttgtttca
gaaaaagctttgaagaaacataatttaacaccgttagcgcgtattgtttcttgggcttca
gctggtgttgatccaagaattatgggtactgcacctgtacctgcatctaaaaaagcatta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgca
gcacaaagtatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagtggtggacgtcttcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtattggtatttctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system