KEGG   Rickettsia prowazekii Chernikova: M9W_01235Help
Entry
M9W_01235         CDS       T01789                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rpw  Rickettsia prowazekii Chernikova
Pathway
rpw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M9W_01235
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    M9W_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 DUF5326
Motif
Other DBs
NCBI-ProteinID: AFE49072
Position
complement(308099..308626)
Genome map
AA seq 175 aa AA seqDB search
MTGKELNKIVAAILFASLIAMIVGFIANILYKPNLHVLHRGYSIAIQKSSSNESATVIAQ
ESVNIQELMKTANANHGREIAKKCLMCHSLDKDGPNKLGPHLWNIVGRPKASITDYKYSF
AISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHDQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaaagagttaaataaaattgttgcagcaatcttatttgctagtttaattgct
atgattgttggatttattgcaaatatattatataaaccaaacttacatgttttacatcgc
ggttatagcattgcaattcaaaaatcatcaagcaatgaaagtgctacagtaatcgcgcaa
gaatcggtaaatatacaggaattgatgaaaactgctaacgcaaatcatggtcgtgaaata
gcaaaaaaatgtttaatgtgtcattctcttgacaaagacggtccaaataaactaggacca
catctttggaatatagtaggaagaccaaaagcaagcataacagactataaatactccttt
gctatatcaaaacttggaggcgtatgggatgatgaaaatttatttgcttttttacacaaa
ccaagtagctatgccccaggaactaaaatgtcctttgcaggtatctcaaaaccacaagac
atagctgatgtaatattatttttaaaaaactatgttcatgatcaataa

DBGET integrated database retrieval system