KEGG   Rickettsia prowazekii Chernikova: M9W_02540Help
Entry
M9W_02540         CDS       T01789                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpw  Rickettsia prowazekii Chernikova
Pathway
rpw00010  Glycolysis / Gluconeogenesis
rpw00020  Citrate cycle (TCA cycle)
rpw00620  Pyruvate metabolism
rpw01100  Metabolic pathways
rpw01110  Biosynthesis of secondary metabolites
rpw01120  Microbial metabolism in diverse environments
rpw01130  Biosynthesis of antibiotics
rpw01200  Carbon metabolism
Module
rpw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M9W_02540
   00020 Citrate cycle (TCA cycle)
    M9W_02540
   00620 Pyruvate metabolism
    M9W_02540
Enzymes [BR:rpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M9W_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFE49333
Position
complement(652898..654124)
Genome map
AA seq 408 aa AA seqDB search
MPIKILMPALSPTMREGNLARWLKKEGDKVNPGEVIAEIETDKATMEVESVDEGILAKII
IPQNSQNVPVNSLIAVLSEEGEDKADIDSFIAQNNSVSLSLKTDATLKKSNDSITNVEGI
KHDSNKIFASPLAKRLAKIGDIRLENVQGSGPHGRIVKQDILSYDSSTSSNKIVYRDTEE
YRSVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDVREDINKSFSEDKVTKISVN
DFIILAVAKALQEVPNANASWSEDAIRYYNNVDISVAVAIENGIVTPIVKDANKKNIIEL
SREMKTLIKKAKDNKLTPIEFQGGGFTISNLGMYGIKNFNAIINTPQSCIMGVGASTKRA
IVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIENPVLMLI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttgtctccaactatgagagaggggaatctagct
aggtggttaaaaaaagaaggggacaaagtaaatcccggggaagtaattgctgaaattgaa
actgataaagcaacaatggaagtagaatcagtagacgaaggtatacttgccaaaataatt
attccgcaaaatagtcaaaatgtacctgttaactctttaattgcagtattaagtgaagaa
ggagaagataaagcagatattgattcgtttattgcacaaaataatagtgtatcactatca
ctaaaaacagatgctactcttaagaaatcaaatgatagcataactaatgtagaaggtata
aaacatgattccaataaaatatttgcctcaccacttgcaaaaaggcttgcaaaaattgga
gatattagacttgagaatgtgcaaggtagtggaccgcacggtagaatagtcaaacaagat
atattatcatatgattctagcacttcttctaataaaatagtgtatagagatactgaagaa
tatcgttcagtaccaaataataatatccgaaagattatagccaagcgtttgcttgaatcg
aaacaaacagttccacatttttatttatctatagaatgtaatgttgataaattattagat
gtaagggaagacattaataaatctttttctgaagataaagtaacaaagatatcggttaat
gattttataattttagctgtagccaaagctttacaagaagtgccaaatgctaatgctagc
tggtcagaagatgcgattagatattacaataatgtcgatatttcagtggcggtagcaatc
gagaacggtattgttacaccgatagttaaagatgctaacaaaaagaatattatagaacta
tctcgtgaaatgaaaacattaataaagaaagcaaaagataataaattaactcctatagaa
tttcagggtggaggatttacaatttctaatctcggaatgtacggtattaagaattttaat
gctattattaatacaccgcaaagttgtataatgggtgtcggagctagtacaaaacgtgct
atagtcaagaatgatcaaataatcatcgcaacaattatggatgttactctttctgccgat
caccgagtaatagacggagcagtaagtgctgagttcttggcatcatttaaaaggtttata
gagaatcctgttttgatgttgatataa

DBGET integrated database retrieval system