KEGG   Rickettsia prowazekii Chernikova: M9W_03565Help
Entry
M9W_03565         CDS       T01789                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpw  Rickettsia prowazekii Chernikova
Pathway
rpw00071  Fatty acid degradation
rpw00280  Valine, leucine and isoleucine degradation
rpw00310  Lysine degradation
rpw00362  Benzoate degradation
rpw00380  Tryptophan metabolism
rpw00620  Pyruvate metabolism
rpw00630  Glyoxylate and dicarboxylate metabolism
rpw00640  Propanoate metabolism
rpw00650  Butanoate metabolism
rpw00900  Terpenoid backbone biosynthesis
rpw01100  Metabolic pathways
rpw01110  Biosynthesis of secondary metabolites
rpw01120  Microbial metabolism in diverse environments
rpw01130  Biosynthesis of antibiotics
rpw01200  Carbon metabolism
rpw01212  Fatty acid metabolism
rpw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M9W_03565
   00630 Glyoxylate and dicarboxylate metabolism
    M9W_03565
   00640 Propanoate metabolism
    M9W_03565
   00650 Butanoate metabolism
    M9W_03565
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M9W_03565
   00072 Synthesis and degradation of ketone bodies
    M9W_03565
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M9W_03565
   00310 Lysine degradation
    M9W_03565
   00380 Tryptophan metabolism
    M9W_03565
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M9W_03565
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M9W_03565
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M9W_03565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpw04147]
    M9W_03565
Enzymes [BR:rpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M9W_03565
Exosome [BR:rpw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M9W_03565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: AFE49533
Position
complement(922446..923624)
Genome map
AA seq 392 aa AA seqDB search
MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITG
GSGQNPARQTLIYADIPQEVPGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMS
LGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDAFAL
SSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRHNTSIEILSKLRPAFDKNGV
VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLIT
LIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtcttagtacaattccagcaccaatgttagctgcttatttaatcaaggatatactgcaa
aatagtaaaatcgagcctgctttagtaaatgaggtaatacttggacaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgccgatataccgcaagaagtt
ccaggttatactattaataaagtatgtggctcaggtcttaaaagtatagcacttgcagca
aattcaattattacatgcgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggatctaaattcggcgatatcaaaatggtt
gatctcatgcaatatgatggtttaatagatgtattttcaggagtatttatgggtattact
gccgaaaatatcgcgaagcagtttaatattagtcggcaagagcaggacgcattcgcctta
agttctcacaagaaagctgctaaagcacaattatcaggaattctacaagatgaaatcttg
cctatagaggtaacagtaaaaaaaaatactagtttgtttgatcatgatgaaacagtaaga
cataatacaagcattgaaattcttagtaaattacgccctgcttttgataaaaatggtgta
gttacagctggtaactcttcctctattaatgacggtgcagcatgtgttctgcttgtttca
gaaaaagctttgaagaaacataatttaacaccgttagcgcgtattgtttcttgggcttca
gctggtgttgatccaagaattatgggtactgcacctgtacctgcatctaaaaaagcatta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcatttgca
gcacaaagtatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagtggtggacgtcttcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtattggtatttctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system