KEGG   Rickettsia prowazekii Chernikova: M9W_04100Help
Entry
M9W_04100         CDS       T01789                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
rpw  Rickettsia prowazekii Chernikova
Brite
KEGG Orthology (KO) [BR:rpw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rpw03009]
    M9W_04100
Enzymes [BR:rpw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     M9W_04100
Ribosome biogenesis [BR:rpw03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    M9W_04100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 DUF192
Motif
Other DBs
NCBI-ProteinID: AFE49640
Position
1063518..1064459
Genome map
AA seq 313 aa AA seqDB search
MLTYNVPKELNNTRLDKALSLLLKKVSRNQVQKAIKNYCVQVNGVIISDSDVLVKENDTI
LFSFKEPEELKITAANITLDIIYEDDDLIVINKAAGMTVHPGIRHHDNTLVNALLHHTKY
LSDIGSAERPGIVHRLDKDTTGLMVVAKNNKTHILLANQIKQRQVIRKYKALVWGVINPL
EGIIKNNVGRNRNNRKKMTILKYGGKKAVTYYKTLELFYGGTLSMVECKLSTGRTHQIRV
QLSNLKHSVVGDQTYGNNNRKIINSPPKLKAKLIAFKRQALHSWYLSFTHPTSNDIMAFS
CELPRDMQEIITD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgttaacctataatgtaccaaaggaactaaacaacacaaggcttgataaagctttatca
ttactcctgaaaaaggtctcaagaaatcaagttcaaaaagctattaagaattattgtgta
caagttaatggtgtgattatttctgattctgatgttttggtcaaggagaatgatactata
ttattttcttttaaagagcctgaagagctaaaaattacagcagcaaatataacacttgat
ataatttatgaagatgatgatttgatagtaattaacaaagcagcaggtatgactgtacat
ccaggtataagacatcacgataatactcttgttaacgcattactgcaccatacaaagtat
ctatcagatattggttcagcagaaagaccaggcatagtacatcgtttagataaagacact
acaggtttaatggttgttgctaaaaataataaaacacatattctgcttgccaatcagata
aaacaaaggcaggtaatacggaaatataaagcattagtttggggagtaattaatccacta
gaaggaataattaagaataatgtaggtcgtaatagaaataatcgaaaaaaaatgacaata
ttaaaatacggcggcaaaaaagctgttacgtattacaagactttagagctattttacggc
ggtactcttagtatggtggaatgcaagcttagtaccgggagaacgcaccaaatcagagta
cagttaagtaatttaaagcattcagtagttggtgaccaaacttatggtaataacaaccgt
aaaattattaattcaccacctaaactaaaagctaaattaatagcttttaaacgccaagct
cttcattcttggtatttaagttttacacatccaactagtaatgatattatggcattttct
tgtgaactaccaagagatatgcaagagatcataaccgattag

DBGET integrated database retrieval system