KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0213Help
Entry
Rpdx1_0213        CDS       T01381                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpx  Rhodopseudomonas palustris DX-1
Brite
Enzymes [BR:rpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rpdx1_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD Methyltransf_11 MTS Methyltransf_23 Ubie_methyltran GCD14 CMAS
Motif
Other DBs
NCBI-ProteinID: ADU41856
UniProt: E6VH84
Position
239038..239763
Genome map
AA seq 241 aa AA seqDB search
MTSPASGIPPPLNGRSFAVLRELMVERQIVARGVHDPRVLAAIRKVPREAFLPEPMRDLA
YEDAPVPIAGEQTMSQPYIVALMMEALLLQGGDNVLEIGTGSGYAAAVLGEIAGHVATVE
RIATLADTAAAKLAELGYVDVHVHQGDGTRGWPPDAPYDAIVVAAGGPQVPDSLKAQLKI
GGRLVMPVGADQHAQQLVRLTRLGEADFKRDHLGDVRFVPLLGAEGWQRVEPADKTARDN
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctccagcttcgggaatcccgccgccgctgaacgggcgatcgttcgcggtgctg
cgcgagttgatggtcgagcgccagatcgttgcgcgcggcgtgcatgatccgcgggtgctc
gccgcgattcgcaaggtgccgcgcgaagccttcctgcccgaaccgatgcgcgatctggcg
tacgaagacgctccggtgccgatcgccggcgagcagacgatgtcgcagccctacatcgtg
gctctgatgatggaagcgctgctgctgcagggcggcgacaatgtgcttgagatcggtacc
ggctccggctacgccgctgcggtgctgggcgagatcgccggacacgtcgccacggtcgag
cgcatcgccacgctggcggatactgcggcggccaagcttgccgaactcggctacgttgat
gtccacgtgcatcagggcgacggcacccgcggctggccgccggacgctccctacgacgcc
atcgtggtcgcagccggcggaccgcaggtgccggactcactgaaggcgcaactgaagatc
ggcggccgtctggtgatgccggtcggagccgatcagcacgcccagcaactggtacggctg
acgcggctcggcgaggccgacttcaagcgcgaccatctcggcgacgtccgcttcgtgccg
ctgctcggcgccgaaggctggcagcgggtcgagcccgccgacaaaacggcacgcgacaac
ggatga

DBGET integrated database retrieval system