KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0450Help
Entry
Rpdx1_0450        CDS       T01381                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00020  Citrate cycle (TCA cycle)
rpx00310  Lysine degradation
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01120  Microbial metabolism in diverse environments
rpx01130  Biosynthesis of antibiotics
rpx01200  Carbon metabolism
Module
rpx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpdx1_0450
  Amino acid metabolism
   00310 Lysine degradation
    Rpdx1_0450
Enzymes [BR:rpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rpdx1_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADU42091
UniProt: E6VJU1
Position
488368..489609
Genome map
AA seq 413 aa AA seqDB search
MTEIRVPTLGESVTEATIGRWFKQPGEAVAVDEPLVELETDKVTIEVPAPSAGTLGEIVA
KDGETVAVGALLGQITDGAAPAKPAAAAPAKAAPAPAAQAPAPAAPAAKTPPSDAPLAPS
VRRLSTESGVDASTVPGSGKDGRVTKGDMLAAIEKAASAPTPVNQPAAAVQVRAPSPADD
AAREERVKMTRLRQTIARRLKEVQNTAAMLTTFNEVDMTNVMALRAQYKDVFEKKHGAKL
GFMGFFTKACVQALKDIPAVNAEIDGTDLIYKNYYHVGVAVGTDKGLVVPVVRDCDTKSI
AEIETSISDFGRRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHKIQ
ERPVVVGGKIEVRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARLVLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaattcgcgttccgacgctcggcgaatcggtgaccgaggcgaccatcggccgc
tggttcaagcagccgggcgaggcggtggcggtcgacgaaccgctcgtcgagctcgagacc
gacaaggtgaccatcgaggtgccggctccatcggccggcacgctgggcgagatcgtcgcc
aaggatggcgagaccgtcgctgtcggcgcgctgctcggccagatcaccgatggcgccgcc
ccggccaagccggctgccgccgctcccgccaaggccgcgccggcgcccgccgcgcaggct
ccggcgcccgctgcgcccgccgccaagaccccgccgtcagatgcgccgctggcgccgtcg
gtgcgccggctgtcgaccgaaagcggcgtcgacgcatcgaccgtgccgggctcgggcaag
gacggccgcgtcaccaagggcgacatgctggcggcgatcgagaaggcggcgtctgcgccg
accccggtcaatcagcccgcggccgccgtacaggtccgggcgccgtcgccggccgacgac
gccgcgcgcgaagagcgggtcaagatgacccggctgcgccagaccatcgcgcgccgcctg
aaggaagtgcagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatgaccaac
gtcatggcgctgcgcgcgcagtacaaggacgtgttcgaaaagaagcacggcgccaagctc
ggcttcatgggattcttcaccaaggcctgcgtccaggccctgaaggacatcccggccgtc
aacgccgagatcgacggcaccgacctgatctacaagaactactatcacgtcggcgtcgcg
gtcggcaccgacaagggtctggttgtgccggtggtgcgcgactgcgacaccaagtcgatc
gccgaaatcgaaacttcgatctccgacttcggccggcgcgcccgtgacggtcagctcaag
atcgaagagatgcagggcggcaccttcaccatcaccaacggcggcatctacggctcgctg
atgtcgaccccgatcctgaacgcgccgcagtccggcatcctcggcatgcacaagatccag
gaacgcccggtggtggtcggcggcaagatcgaggtgcggccgatgatgtatctggcgctg
agctacgaccaccgcgtgatcgacggcaaggaagcggtgaccttcctggtccgtgtcaag
gaaagcctggaagatccggcccggctggtgctggatctctga

DBGET integrated database retrieval system